(data stored in ACNUC7421 zone)

EMBL: CP000462.CYAA

CP000462.CYAA        Location/Qualifiers
FT   CDS             500161..502695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="AHA_0470"
FT                   /product="adenylate cyclase, class I"
FT                   /EC_number="4.6.1.1"
FT                   /note="identified by similarity to SP:P00936; match to
FT                   protein family HMM PF01295"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36798"
FT                   /db_xref="GOA:A0KFH7"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH7"
FT                   /protein_id="ABK36798.1"
FT                   /translation="MLVKLDTLVARYDELNRLKTQRALGLMSRYGQQVFQLLPVMLHFN
FT                   HPLLPGYVAGDVPHGIWSFTANDAQQAFIEDLCQNANCLNGLTTHDKSIQGLYSMGSTS
FT                   SIGQCCHSDLDIWVCHVAGLSQERLELLDLKCQQLSKWAEQRGVDLNFFLIPEDKFRQR
FT                   NDAQMQGESCGSAQHLLLLDEFYRSAMLIAGKRLLWYLVPSEYDDHYDDYVNGLFAHGK
FT                   LSQDDWLDLGGFNRIPAEEYFGSALWQLYKGIDSPYKAVLKSVLMEAYSHEYPNTRLLS
FT                   VTSRDWFQHNEGMHYRLDNYCLMLDKVTNYLKSIGDMQRLDLVRRCFYLKVCDGLSHPK
FT                   EEHSPAWRREQMTQLVSYWGWSQERLHHLDHRQEWKVEDVKVAHAELLEALMQSYRNLI
FT                   QFARRNNISESINPEDIGILSRKLYAAFESLPGKVQRINLKIAPDLSEPDLSFVQVPHG
FT                   RLNRAGWYLYKHSLEPADIIGRAPLEYNGYISKLVSWAYFNGLLTPQSRVHLFNQGSDL
FT                   HIDNLHQFCRDLSGTFPVKYPRATNLALSRPCEIRQLSIFLNLETDPTSHWVGQVIEFD
FT                   ANAADVFSFGRNQECLVGSVDLVYRNSWSEIRTLHFQGDEAVVDALTTILGKMHQDAAA
FT                   PEMIEVFCYSQHFRSLVRTRFQQLVAECIELRLARDKQQLVKTLALGKEKYGIFFERRG
FT                   VSVKKLENAVDFYRHISHNKLDHLPLRLDKTHSQHLPGIVDAYASEGLVQFFFDTRDAG
FT                   TNIYILDEANRVEIYQHFAGNKDELVQGVNRFYTSSHERFSDAGQFSNFNLPQYYEIVQ
FT                   INGELEVIPYRSQGQLRDGGQGRELGSAAGAG"
     MLVKLDTLVA RYDELNRLKT QRALGLMSRY GQQVFQLLPV MLHFNHPLLP GYVAGDVPHG        60
     IWSFTANDAQ QAFIEDLCQN ANCLNGLTTH DKSIQGLYSM GSTSSIGQCC HSDLDIWVCH       120
     VAGLSQERLE LLDLKCQQLS KWAEQRGVDL NFFLIPEDKF RQRNDAQMQG ESCGSAQHLL       180
     LLDEFYRSAM LIAGKRLLWY LVPSEYDDHY DDYVNGLFAH GKLSQDDWLD LGGFNRIPAE       240
     EYFGSALWQL YKGIDSPYKA VLKSVLMEAY SHEYPNTRLL SVTSRDWFQH NEGMHYRLDN       300
     YCLMLDKVTN YLKSIGDMQR LDLVRRCFYL KVCDGLSHPK EEHSPAWRRE QMTQLVSYWG       360
     WSQERLHHLD HRQEWKVEDV KVAHAELLEA LMQSYRNLIQ FARRNNISES INPEDIGILS       420
     RKLYAAFESL PGKVQRINLK IAPDLSEPDL SFVQVPHGRL NRAGWYLYKH SLEPADIIGR       480
     APLEYNGYIS KLVSWAYFNG LLTPQSRVHL FNQGSDLHID NLHQFCRDLS GTFPVKYPRA       540
     TNLALSRPCE IRQLSIFLNL ETDPTSHWVG QVIEFDANAA DVFSFGRNQE CLVGSVDLVY       600
     RNSWSEIRTL HFQGDEAVVD ALTTILGKMH QDAAAPEMIE VFCYSQHFRS LVRTRFQQLV       660
     AECIELRLAR DKQQLVKTLA LGKEKYGIFF ERRGVSVKKL ENAVDFYRHI SHNKLDHLPL       720
     RLDKTHSQHL PGIVDAYASE GLVQFFFDTR DAGTNIYILD EANRVEIYQH FAGNKDELVQ       780
     GVNRFYTSSH ERFSDAGQFS NFNLPQYYEI VQINGELEVI PYRSQGQLRD GGQGRELGSA       840
     AGAG                                                                    844
//

If you have problems or comments...

PBIL Back to PBIL home page