(data stored in ACNUC7421 zone)

EMBL: CP000462.CYSE

CP000462.CYSE        Location/Qualifiers
FT   CDS             207426..208205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="AHA_0192"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF06426;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39160"
FT                   /db_xref="GOA:A0KER0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER0"
FT                   /protein_id="ABK39160.1"
FT                   /translation="MDDLVARTWQKIQQEAASMATEEPMLASFFHSTILNHKNLRSALS
FT                   FQLANKLDSATMPAIALREVIELALRSEPELLAVVAADICAVQERDPAVDLFSTPLLYL
FT                   KGFHALQGYRVANWLWRQGRRSLALYLQNQISVVFGVDVHPAARIGKGIMFDHATGIVV
FT                   GETAVIEDDVSILQSVTLGGTGKESGDRHPKIREGVMIGAGAKVLGNIEVGMGAKIGAG
FT                   SVVINPVPPHTTVAGVPAKIVGRPECDKPSLDMDQCL"
     MDDLVARTWQ KIQQEAASMA TEEPMLASFF HSTILNHKNL RSALSFQLAN KLDSATMPAI        60
     ALREVIELAL RSEPELLAVV AADICAVQER DPAVDLFSTP LLYLKGFHAL QGYRVANWLW       120
     RQGRRSLALY LQNQISVVFG VDVHPAARIG KGIMFDHATG IVVGETAVIE DDVSILQSVT       180
     LGGTGKESGD RHPKIREGVM IGAGAKVLGN IEVGMGAKIG AGSVVINPVP PHTTVAGVPA       240
     KIVGRPECDK PSLDMDQCL                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page