(data stored in ACNUC7421 zone)

EMBL: CP000462.CYSQ-1

CP000462.CYSQ-1      Location/Qualifiers
FT   CDS             618378..619190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ-1"
FT                   /locus_tag="AHA_0584"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by match to protein family HMM PF00459;
FT                   match to protein family HMM TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35844"
FT                   /db_xref="GOA:A0KFU1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU1"
FT                   /protein_id="ABK35844.1"
FT                   /translation="MQELLAWVPGVKEIAREAGRILHEIYHGGQFERQLKEDATPVTSA
FT                   DLAADAYLKQALSALTPHVPVLTEEAADIPFSQRANWRQYWLVDPLDGTGEFIAGSGDF
FT                   ATLIALVQDNVPVLGVIYAPESNVLYWAVRGHGAFKEANGEVHPISAMHHEHDQPDSLV
FT                   VAISRRQKLENLTRRLNPAINYELIPLGSSSLKSCLVAEGAADCYVRLGPTGEWDTAAA
FT                   QCIVEAAGGRILSLALQPLRYNETESLENPDFIVMGDPDLAWGSILAH"
     MQELLAWVPG VKEIAREAGR ILHEIYHGGQ FERQLKEDAT PVTSADLAAD AYLKQALSAL        60
     TPHVPVLTEE AADIPFSQRA NWRQYWLVDP LDGTGEFIAG SGDFATLIAL VQDNVPVLGV       120
     IYAPESNVLY WAVRGHGAFK EANGEVHPIS AMHHEHDQPD SLVVAISRRQ KLENLTRRLN       180
     PAINYELIPL GSSSLKSCLV AEGAADCYVR LGPTGEWDTA AAQCIVEAAG GRILSLALQP       240
     LRYNETESLE NPDFIVMGDP DLAWGSILAH                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page