(data stored in ACNUC7421 zone)

EMBL: CP000462.DNAN

CP000462.DNAN        Location/Qualifiers
FT   CDS             1677..2780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="AHA_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37675"
FT                   /db_xref="GOA:A0KEE7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE7"
FT                   /protein_id="ABK37675.1"
FT                   /translation="MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLT
FT                   GTDLEVEMIGQVYLNSDSQDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSGRS
FT                   RFNLSTLPATEYPNIEDWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLFESE
FT                   GHGLRTVATDGHRLATCRREVVTESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRS
FT                   NLRAALDGFIFTSKLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRG
FT                   VRLNLQENLLRITANNPEQEEAEELLDVQYEAGEMEIGFNVSYVLDVLNTLKCDQIRIS
FT                   LSDSISSAIIEDFDSQDAQYVVMPMRI"
     MQLEISREAL LRPLQLVSGA LGGRPTLPIL GNVLLDVSNG LLSLTGTDLE VEMIGQVYLN        60
     SDSQDGRTTV PARKLLDICR GLPEGADIRL NTEGERLIIR SGRSRFNLST LPATEYPNIE       120
     DWESVLEFDI GQLELKKLID ATQFSMASQD VRYYLNGMLF ESEGHGLRTV ATDGHRLATC       180
     RREVVTESLP DHQVILPRKG VLELVRLLEA EDKPVRLQIG RSNLRAALDG FIFTSKLVDG       240
     RFPDWRRVIP RNSDKALIAG REDLRQAFAR AAILSNEKFR GVRLNLQENL LRITANNPEQ       300
     EEAEELLDVQ YEAGEMEIGF NVSYVLDVLN TLKCDQIRIS LSDSISSAII EDFDSQDAQY       360
     VVMPMRI                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page