(data stored in ACNUC7421 zone)

EMBL: CP000462.DPRA

CP000462.DPRA        Location/Qualifiers
FT   CDS             284930..286045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="AHA_0260"
FT                   /product="DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39832"
FT                   /db_xref="GOA:A0KEX2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX2"
FT                   /protein_id="ABK39832.1"
FT                   /translation="MPLPSGRLALWLTLDAVTGIGPVTAARLLAHFGGDIVTLFDTDDG
FT                   ALRALGLQSVQVQQMRWPQPVVEQALSWAAEPGNHLLCPDDPAYPALLKEIPAAPLLLY
FT                   CRGNLAALSVPQLAMVGTRHPTYAGKDNAARLCSELVACGLAITSGLALGIDGVCHQQA
FT                   LAAGGTTLAVLGSGLDCLYPKRHQGLAMEILVRGGLLISELAPDKGPLAEHFPRRNRII
FT                   SGLSLGTLVVEAAEQSGSLITARYALEQGREVFAVPGAPQNVQALGCNKLIQQGAKLVL
FT                   SAADIVEELPGFVGLLQQVADLSEHSNNSELPYADLLDNVDYETTSVDTVAERSQLPVE
FT                   VVLGRLVELELAGAVMAVAGGYVRARRANHV"
     MPLPSGRLAL WLTLDAVTGI GPVTAARLLA HFGGDIVTLF DTDDGALRAL GLQSVQVQQM        60
     RWPQPVVEQA LSWAAEPGNH LLCPDDPAYP ALLKEIPAAP LLLYCRGNLA ALSVPQLAMV       120
     GTRHPTYAGK DNAARLCSEL VACGLAITSG LALGIDGVCH QQALAAGGTT LAVLGSGLDC       180
     LYPKRHQGLA MEILVRGGLL ISELAPDKGP LAEHFPRRNR IISGLSLGTL VVEAAEQSGS       240
     LITARYALEQ GREVFAVPGA PQNVQALGCN KLIQQGAKLV LSAADIVEEL PGFVGLLQQV       300
     ADLSEHSNNS ELPYADLLDN VDYETTSVDT VAERSQLPVE VVLGRLVELE LAGAVMAVAG       360
     GYVRARRANH V                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page