(data stored in ACNUC7421 zone)

EMBL: CP000462.DTD

CP000462.DTD         Location/Qualifiers
FT   CDS             305191..305628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="AHA_0281"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF02580;
FT                   match to protein family HMM TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39550"
FT                   /db_xref="GOA:A0KEZ2"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEZ2"
FT                   /protein_id="ABK39550.1"
FT                   /translation="MIALIQRVSEASVTVEGEMTGAIGQGLLVLLGVEQGDDEAKADKL
FT                   LHKVSGYRIFSDENGKMNLNVSQAGGGLLVVSQFTLAADTNKGMRPSFSGGAHPVEAER
FT                   LYDYFVAQAAASGIPTATGRFAADMKVALVNDGPVTFWLQV"
     MIALIQRVSE ASVTVEGEMT GAIGQGLLVL LGVEQGDDEA KADKLLHKVS GYRIFSDENG        60
     KMNLNVSQAG GGLLVVSQFT LAADTNKGMR PSFSGGAHPV EAERLYDYFV AQAAASGIPT       120
     ATGRFAADMK VALVNDGPVT FWLQV                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page