(data stored in ACNUC7421 zone)

EMBL: CP000462.EDA

CP000462.EDA         Location/Qualifiers
FT   CDS             317302..317943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="AHA_0289"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38114"
FT                   /db_xref="GOA:A0KF01"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF01"
FT                   /protein_id="ABK38114.1"
FT                   /translation="MQNWKVTPAEVFAASPLVPVMVINELEQALPMAKALLDGGISVFE
FT                   ITLRTPVALEAIALIAKAMPDAMVGAGTVLNCAQFDAAVAAGARFVISPGMTPALLAHA
FT                   ANSTAPLIPGVATPSEVMQALEAGYDHLKFFPAEANGGTKALAAIAAPLPQVKFCPTGG
FT                   IGPKNVADYLALKCVATVGGSWMLPAEAVKNGNWEEVTRLSREAVALVAS"
     MQNWKVTPAE VFAASPLVPV MVINELEQAL PMAKALLDGG ISVFEITLRT PVALEAIALI        60
     AKAMPDAMVG AGTVLNCAQF DAAVAAGARF VISPGMTPAL LAHAANSTAP LIPGVATPSE       120
     VMQALEAGYD HLKFFPAEAN GGTKALAAIA APLPQVKFCP TGGIGPKNVA DYLALKCVAT       180
     VGGSWMLPAE AVKNGNWEEV TRLSREAVAL VAS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page