(data stored in ACNUC7421 zone)

EMBL: CP000462.EDD

CP000462.EDD         Location/Qualifiers
FT   CDS             315485..317281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="AHA_0288"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR01196"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38540"
FT                   /db_xref="GOA:A0KF00"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF00"
FT                   /protein_id="ABK38540.1"
FT                   /translation="MIHQVISSVTARIRERSAARRQAFLARIQRQADQGKTRAALACGN
FT                   LAHAVAASSCDEKGRILDMTRANVGIVTAYNDMLSAHQPYQGYPDIIKAALAELGHSAQ
FT                   VAGGVPAMCDGVTQGQPGMDMSLFSRDLIAQATALSLSHNTFDATLLLGICDKIAPGQI
FT                   MGALSHAHLPTAFVPAGPMASGISNDEKVKVRQQYAAGEVGRDALLQMECGAYHAAGTC
FT                   TFYGTANTNQLVFEAMGLMLPGSAFVHPHSELRRALTEEAARRISAMIPGSPAYRPLSA
FT                   VIDERSLVNGLVALLASGGSTNHSIHMVALARAAGLHLTWDDISDLSDVVPLLVRMYPN
FT                   GPADVNAFEQAGGVPGLMRRLAEEGLIHLDATPVFGEMQDYLSRPALVDGQLVWQPVGE
FT                   SGDASVLSPSGSVFQATGGTKLLAGNLGRAVVKVSAVAPEYRVIEAPARVFSSQHAVEA
FT                   AYKAGDLNQDAVIVVRHNGPAANGMPELHKLMPVLGNLQKAGYKVALVTDGRLSGASGK
FT                   IPAAIHVTPEALHGGAIGLLADGDLLRVDAVNGSLDCLTDLSGRTQAEIDLTLEQEGWG
FT                   RELFSVMRRAVSSAECGATIFD"
     MIHQVISSVT ARIRERSAAR RQAFLARIQR QADQGKTRAA LACGNLAHAV AASSCDEKGR        60
     ILDMTRANVG IVTAYNDMLS AHQPYQGYPD IIKAALAELG HSAQVAGGVP AMCDGVTQGQ       120
     PGMDMSLFSR DLIAQATALS LSHNTFDATL LLGICDKIAP GQIMGALSHA HLPTAFVPAG       180
     PMASGISNDE KVKVRQQYAA GEVGRDALLQ MECGAYHAAG TCTFYGTANT NQLVFEAMGL       240
     MLPGSAFVHP HSELRRALTE EAARRISAMI PGSPAYRPLS AVIDERSLVN GLVALLASGG       300
     STNHSIHMVA LARAAGLHLT WDDISDLSDV VPLLVRMYPN GPADVNAFEQ AGGVPGLMRR       360
     LAEEGLIHLD ATPVFGEMQD YLSRPALVDG QLVWQPVGES GDASVLSPSG SVFQATGGTK       420
     LLAGNLGRAV VKVSAVAPEY RVIEAPARVF SSQHAVEAAY KAGDLNQDAV IVVRHNGPAA       480
     NGMPELHKLM PVLGNLQKAG YKVALVTDGR LSGASGKIPA AIHVTPEALH GGAIGLLADG       540
     DLLRVDAVNG SLDCLTDLSG RTQAEIDLTL EQEGWGRELF SVMRRAVSSA ECGATIFD         598
//

If you have problems or comments...

PBIL Back to PBIL home page