(data stored in ACNUC7421 zone)

EMBL: CP000462.FADA

CP000462.FADA        Location/Qualifiers
FT   CDS             complement(153298..154461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="AHA_0138"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930; match to protein family HMM
FT                   TIGR02445"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39512"
FT                   /db_xref="GOA:A0KEL0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEL0"
FT                   /protein_id="ABK39512.1"
FT                   /translation="MKDVVIVDCIRTPMGRSKGGAFRNVRAEDLSAHLMKSILLRNPNL
FT                   DPNEIEDIYWGCVQQTLEQGFNIARNAALLAGIPKQVGAVTVNRLCGSSMQALHDASRA
FT                   IQVGDGDIFIIGGVEHMGHVPMSHGVDFHPGMAKSVAKASGMMGLTAEMLGKLHGISRQ
FT                   QQDEFAARSHRRAHAATVEGRFAKEIVGLEGHDASGARFFYDYDEVIRPETTVETLSQL
FT                   RPVFDPVNGTVTAGTSSALSDGAAAMLVMSADRAKALGLTPRAKIRAMAVAGCDAAIMG
FT                   YGPVPATQKALKRAGLTIGDIDLFELNEAFAAQSLPCVKDLGLQDVVDEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMEEKDATLGVATMCIGLGQGIATVFERV"
     MKDVVIVDCI RTPMGRSKGG AFRNVRAEDL SAHLMKSILL RNPNLDPNEI EDIYWGCVQQ        60
     TLEQGFNIAR NAALLAGIPK QVGAVTVNRL CGSSMQALHD ASRAIQVGDG DIFIIGGVEH       120
     MGHVPMSHGV DFHPGMAKSV AKASGMMGLT AEMLGKLHGI SRQQQDEFAA RSHRRAHAAT       180
     VEGRFAKEIV GLEGHDASGA RFFYDYDEVI RPETTVETLS QLRPVFDPVN GTVTAGTSSA       240
     LSDGAAAMLV MSADRAKALG LTPRAKIRAM AVAGCDAAIM GYGPVPATQK ALKRAGLTIG       300
     DIDLFELNEA FAAQSLPCVK DLGLQDVVDE KVNLNGGAIA LGHPLGCSGA RISTTLLNLM       360
     EEKDATLGVA TMCIGLGQGI ATVFERV                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page