(data stored in ACNUC7421 zone)

EMBL: CP000462.FIEF

CP000462.FIEF        Location/Qualifiers
FT   CDS             206506..207417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fieF"
FT                   /locus_tag="AHA_0191"
FT                   /product="cation-efflux pump FieF"
FT                   /note="identified by similarity to SP:P69380; match to
FT                   protein family HMM PF01545; match to protein family HMM
FT                   TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36555"
FT                   /db_xref="GOA:A0KEQ9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ9"
FT                   /protein_id="ABK36555.1"
FT                   /translation="MSHQQYFRWVTLASMAAVTTATLLITGKLIAWLMTDSSSLLASLT
FT                   DSFMDVSASIINLLAIRYALSPADDEHRFGHGKAESLAGLIQAAFISGSALLLVMHGIS
FT                   SLLKQAPLERLEAGLWVSGGSIVLTLLLVSFQSLVIRKTNSVAIKADMLHYRSDLLLNG
FT                   GVLLALVLAGQGWYWADGLFAILIGLFLLWGALHIGYESVQALLDRQLPAEEQARIMAL
FT                   CCDVEGVHGVHDLRTRQSGPTRFVQLHLELDDQLPLVKAHQIADEAELAVRQAFERMDV
FT                   IIHMDPISVVHKEQQGTPSEQQ"
     MSHQQYFRWV TLASMAAVTT ATLLITGKLI AWLMTDSSSL LASLTDSFMD VSASIINLLA        60
     IRYALSPADD EHRFGHGKAE SLAGLIQAAF ISGSALLLVM HGISSLLKQA PLERLEAGLW       120
     VSGGSIVLTL LLVSFQSLVI RKTNSVAIKA DMLHYRSDLL LNGGVLLALV LAGQGWYWAD       180
     GLFAILIGLF LLWGALHIGY ESVQALLDRQ LPAEEQARIM ALCCDVEGVH GVHDLRTRQS       240
     GPTRFVQLHL ELDDQLPLVK AHQIADEAEL AVRQAFERMD VIIHMDPISV VHKEQQGTPS       300
     EQQ                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page