(data stored in ACNUC7421 zone)

EMBL: CP000462.GLNA

CP000462.GLNA        Location/Qualifiers
FT   CDS             complement(300492..301901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="AHA_0277"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37740"
FT                   /db_xref="GOA:A0KEY9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY9"
FT                   /protein_id="ABK37740.1"
FT                   /translation="MSAQNVLALIQEHEVKFVDLRFTDTKGKEQHVSIPSHQVDEDFFE
FT                   DGKMFDGSSIGGWKGINESDMVLMPDAASAKLDPFTEETTLNIVCDVLEPATMQGYDRD
FT                   PRSIAKRAEDFLKSSGIADTVLFGPEPEFFMFDNITFSNTMGHSFVKIESEEAAWNSGT
FT                   DYEHGNKGHRPFVKGGYFPVAPVDSSQDIRAAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTLKADEVQVLKYVIHNVAHAYNKTVTFMPKPMFGDNGSGMHCHQSLAKNGVN
FT                   LFAGDLYGGLSEMALHYIGGIIKHAKAINAFANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVPSPKARRIEVRFPDPAANPYLAFAAQLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEAAEVPTVAGSLDEALAALDADREFLTRGGVFSDDFINSYLELKQQDVDRVRMTP
FT                   HPLEFELYYSV"
     MSAQNVLALI QEHEVKFVDL RFTDTKGKEQ HVSIPSHQVD EDFFEDGKMF DGSSIGGWKG        60
     INESDMVLMP DAASAKLDPF TEETTLNIVC DVLEPATMQG YDRDPRSIAK RAEDFLKSSG       120
     IADTVLFGPE PEFFMFDNIT FSNTMGHSFV KIESEEAAWN SGTDYEHGNK GHRPFVKGGY       180
     FPVAPVDSSQ DIRAAMCLVL EEMGQVVEAH HHEVATAGQN EIATRFNTLT LKADEVQVLK       240
     YVIHNVAHAY NKTVTFMPKP MFGDNGSGMH CHQSLAKNGV NLFAGDLYGG LSEMALHYIG       300
     GIIKHAKAIN AFANPTTNSY KRLVPGYEAP VMLAYSARNR SASIRIPVVP SPKARRIEVR       360
     FPDPAANPYL AFAAQLMAGL DGIINKIHPG DAMDKNLYDL PPEEAAEVPT VAGSLDEALA       420
     ALDADREFLT RGGVFSDDFI NSYLELKQQD VDRVRMTPHP LEFELYYSV                   469
//

If you have problems or comments...

PBIL Back to PBIL home page