(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPC

CP000462.GSPC        Location/Qualifiers
FT   CDS             602786..603709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="AHA_0568"
FT                   /product="general secretion pathway protein C"
FT                   /note="identified by similarity to GB:AAA58784.1; match to
FT                   protein family HMM TIGR01713"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36389"
FT                   /db_xref="GOA:A0KFS5"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS5"
FT                   /protein_id="ABK36389.1"
FT                   /translation="MPYTIANRFGCQKILINMTLPFRDDLLSSLLARCKTVPLSRFSQP
FT                   LFWLLLLLLAHQCAGLTWRLLDLGSRPVSQSWQPSVVANQSQGANRLDLSGVSRLALFG
FT                   KAKQQAQAADVVAADAPKTQLNAQLNGVLASSDPAKSIAIIAHNGLQNSYGIGDLIDGT
FT                   QAKIRQVFPDRVIIERDGRDETLMLDGEEYGKPLPKPGNQDGKLSSVRNELMGNPGKIT
FT                   DYLNISPVRVDGRMVGYRLNPGSNPELFNQLGLVANDMAVSINGLDLRDNAQAMQAMQQ
FT                   VAGATEMTVTVERQGQLYDVYVGLSE"
     MPYTIANRFG CQKILINMTL PFRDDLLSSL LARCKTVPLS RFSQPLFWLL LLLLAHQCAG        60
     LTWRLLDLGS RPVSQSWQPS VVANQSQGAN RLDLSGVSRL ALFGKAKQQA QAADVVAADA       120
     PKTQLNAQLN GVLASSDPAK SIAIIAHNGL QNSYGIGDLI DGTQAKIRQV FPDRVIIERD       180
     GRDETLMLDG EEYGKPLPKP GNQDGKLSSV RNELMGNPGK ITDYLNISPV RVDGRMVGYR       240
     LNPGSNPELF NQLGLVANDM AVSINGLDLR DNAQAMQAMQ QVAGATEMTV TVERQGQLYD       300
     VYVGLSE                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page