(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPD

CP000462.GSPD        Location/Qualifiers
FT   CDS             603731..605764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="AHA_0569"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by similarity to SP:P45758; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38515"
FT                   /db_xref="GOA:A0KFS6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS6"
FT                   /protein_id="ABK38515.1"
FT                   /translation="MINKGKGWRLATVAAALMMAGSAWATEYSASFKNADIEEFINTVG
FT                   KNLNKTIIIEPSVRGKINVRSYDLLNEDQYYQFFLSVLDVYGFAVVPMDNGVLKVVRSK
FT                   DAKTSAIPVVDESNPGSGDEMVTRVVPVRNVSVRELAPLLRQLNDNAGGGNVVHYDPSN
FT                   VLLITGRAAVVNRLVEVVRRVDKAGDQEVDIVKLKYASAGEMVRLVTNLNKDGNNQGGN
FT                   TSLLLAPKVVADERTNSVVVSGEPKARARIIQMVHQLDRDLQSQGNTRVFYLKYGKAKD
FT                   LVEVLKGVSSSIEADKKGGAATTTGGGGASIGGGKLAISADETTNALVITAQPDVMAEL
FT                   EQVVAKLDIRRAQVLVEAIIVEIADGDGLNLGVQWANTNGGGTQFTDTNLPIGSVAIAA
FT                   KDYQKNGTTTGLAALAKDFNGMAAGFYKGNWAALVTALSTNTKNDILSTPSIVTMDNKE
FT                   ASFNVGQEVPVQSGSQSSTTSDQVFNTIERKTVGTKLVVTPQINEGDSVLLNIEQEVSS
FT                   VAQTQAPGTSTLGPTFDTRTIKNAVLVKSGETVVLGGLMDEKTQEKVSKVPLLGDIPVL
FT                   GYLFRSTSNSTSKRNLMVFIRPTILRDADVYSGISSNKYSQFRSEQQEAAAQEGYLTSP
FT                   KRQVLPQYGQGVTMSPEVQKQLQQTQQAPQASGGSQPFVGNK"
     MINKGKGWRL ATVAAALMMA GSAWATEYSA SFKNADIEEF INTVGKNLNK TIIIEPSVRG        60
     KINVRSYDLL NEDQYYQFFL SVLDVYGFAV VPMDNGVLKV VRSKDAKTSA IPVVDESNPG       120
     SGDEMVTRVV PVRNVSVREL APLLRQLNDN AGGGNVVHYD PSNVLLITGR AAVVNRLVEV       180
     VRRVDKAGDQ EVDIVKLKYA SAGEMVRLVT NLNKDGNNQG GNTSLLLAPK VVADERTNSV       240
     VVSGEPKARA RIIQMVHQLD RDLQSQGNTR VFYLKYGKAK DLVEVLKGVS SSIEADKKGG       300
     AATTTGGGGA SIGGGKLAIS ADETTNALVI TAQPDVMAEL EQVVAKLDIR RAQVLVEAII       360
     VEIADGDGLN LGVQWANTNG GGTQFTDTNL PIGSVAIAAK DYQKNGTTTG LAALAKDFNG       420
     MAAGFYKGNW AALVTALSTN TKNDILSTPS IVTMDNKEAS FNVGQEVPVQ SGSQSSTTSD       480
     QVFNTIERKT VGTKLVVTPQ INEGDSVLLN IEQEVSSVAQ TQAPGTSTLG PTFDTRTIKN       540
     AVLVKSGETV VLGGLMDEKT QEKVSKVPLL GDIPVLGYLF RSTSNSTSKR NLMVFIRPTI       600
     LRDADVYSGI SSNKYSQFRS EQQEAAAQEG YLTSPKRQVL PQYGQGVTMS PEVQKQLQQT       660
     QQAPQASGGS QPFVGNK                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page