(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPE

CP000462.GSPE        Location/Qualifiers
FT   CDS             605764..607269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="AHA_0570"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by similarity to SP:P31741; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37044"
FT                   /db_xref="GOA:A0KFS7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS7"
FT                   /protein_id="ABK37044.1"
FT                   /translation="MAAYQLDGVDMPAALPELPFAFARNFGVILTERQGAPVLLCRQGV
FT                   TPQTLLEVRRVAGCAFTVEQMDREAFEELLMAHYQRDSSEARQLMEDLGNEMDFFALAE
FT                   ELPQSEDLLDADDDAPIIRLINAMLSEAIKEEASDIHIETFERALVIRFRIDGVLREIL
FT                   RPHRKLASLLVSRIKVMSRMDIAEKRVPQDGRISLRIGGRAVDVRVSTMPSSYGERVVL
FT                   RLLDKNNVRLELKQLGMTLANRNIISELIRKPHGIILVTGPTGSGKSTTLYAALSEINS
FT                   RDRNILTVEDPIEYDLEGVGQTQVNSKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQ
FT                   IAVQASLTGHLVMSTLHTNTAIGAITRMRDMGIEPFLLSSSLLAVLAQRLVRTLCPDCR
FT                   APRAITEQERIAMGIELAPDQQVWRPVGCEQCNHTGYRGRTGIHELVVIDEAVREAIHS
FT                   ASGELAIERLIRGHTPSIRRDGIDKVLKGQTSLEEVLRVTRED"
     MAAYQLDGVD MPAALPELPF AFARNFGVIL TERQGAPVLL CRQGVTPQTL LEVRRVAGCA        60
     FTVEQMDREA FEELLMAHYQ RDSSEARQLM EDLGNEMDFF ALAEELPQSE DLLDADDDAP       120
     IIRLINAMLS EAIKEEASDI HIETFERALV IRFRIDGVLR EILRPHRKLA SLLVSRIKVM       180
     SRMDIAEKRV PQDGRISLRI GGRAVDVRVS TMPSSYGERV VLRLLDKNNV RLELKQLGMT       240
     LANRNIISEL IRKPHGIILV TGPTGSGKST TLYAALSEIN SRDRNILTVE DPIEYDLEGV       300
     GQTQVNSKVD MTFARGLRAI LRQDPDVVMV GEIRDLETAQ IAVQASLTGH LVMSTLHTNT       360
     AIGAITRMRD MGIEPFLLSS SLLAVLAQRL VRTLCPDCRA PRAITEQERI AMGIELAPDQ       420
     QVWRPVGCEQ CNHTGYRGRT GIHELVVIDE AVREAIHSAS GELAIERLIR GHTPSIRRDG       480
     IDKVLKGQTS LEEVLRVTRE D                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page