(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPG

CP000462.GSPG        Location/Qualifiers
FT   CDS             608607..609038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="AHA_0572"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by similarity to SP:P31733; match to
FT                   protein family HMM PF07963; match to protein family HMM
FT                   TIGR01710; match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38698"
FT                   /db_xref="GOA:A0KFS9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS9"
FT                   /protein_id="ABK38698.1"
FT                   /translation="MQKRRQSGFTLLEVMVVIVILGILASLVVPNLMGNKEKADQQKAV
FT                   SDIVALENALDMYKLDNNRYPTTEQGLDALVNKPTAAPEPRSYREGGYIKRLPQDPWGN
FT                   PYQMLSPGQFGKIDIFSMGLDGEAGTDDDIGNWNLKDFQ"
     MQKRRQSGFT LLEVMVVIVI LGILASLVVP NLMGNKEKAD QQKAVSDIVA LENALDMYKL        60
     DNNRYPTTEQ GLDALVNKPT AAPEPRSYRE GGYIKRLPQD PWGNPYQMLS PGQFGKIDIF       120
     SMGLDGEAGT DDDIGNWNLK DFQ                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page