(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPJ

CP000462.GSPJ        Location/Qualifiers
FT   CDS             610178..610807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="AHA_0575"
FT                   /product="general secretion pathway protein J"
FT                   /note="identified by similarity to SP:P31739; match to
FT                   protein family HMM PF07963; match to protein family HMM
FT                   TIGR01711; match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39529"
FT                   /db_xref="GOA:A0KFT2"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT2"
FT                   /protein_id="ABK39529.1"
FT                   /translation="MIRSQRQAGFTLLEMLVAIAIFAGLSLGAYQVLQGVLTSDEVAKR
FT                   KEARLSELQLAFSVLERDITQMVPRSGRIDGENNKVLLAASRFGQQSDDWGMAFMRGGW
FT                   LNPDGMLPRSGLQRVGWRLKDHKLERLSYLYPDPVIGTEPRIQPMLERVTALRLYFYDK
FT                   GAWKEEWTQRNVLPYGLAVELDLEDYGTIRRQFLIGAGGQRAENGN"
     MIRSQRQAGF TLLEMLVAIA IFAGLSLGAY QVLQGVLTSD EVAKRKEARL SELQLAFSVL        60
     ERDITQMVPR SGRIDGENNK VLLAASRFGQ QSDDWGMAFM RGGWLNPDGM LPRSGLQRVG       120
     WRLKDHKLER LSYLYPDPVI GTEPRIQPML ERVTALRLYF YDKGAWKEEW TQRNVLPYGL       180
     AVELDLEDYG TIRRQFLIGA GGQRAENGN                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page