(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPK

CP000462.GSPK        Location/Qualifiers
FT   CDS             610897..611922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="AHA_0576"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by similarity to SP:P31760; match to
FT                   protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39209"
FT                   /db_xref="GOA:A0KFT3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT3"
FT                   /protein_id="ABK39209.1"
FT                   /translation="MAIKRGRGRSRTTPGRQGGMALLVVLLILSVMVIIASNMSGRLQL
FT                   ELRRTANLTAGKQAWWYAMSAEALVSKVLAQDFKDDPNVVSLGQNWARQDAVFPVDDGK
FT                   LTGRVRDLQSCFNLNSLSVPLKDGISGDDLEKQPYPVKVFKALLKQLEVEDYEAVQLTD
FT                   AIRDWTDKDTVLVSSYGAEDAYYEGLTPPYLTANQWMLGTDELRAVRGVSAKLYARLAP
FT                   YVCALPNDKLVVNVNTIRPEQSALLVALYLDKVGLDDAKRVLTSRPQKGWKNKKEMTDQ
FT                   MPVQVGNIQGLDAALDVKSSYFEARLIAEVGDTRARLESVFVRGKDNKLVMLRRLNGGA
FT                   E"
     MAIKRGRGRS RTTPGRQGGM ALLVVLLILS VMVIIASNMS GRLQLELRRT ANLTAGKQAW        60
     WYAMSAEALV SKVLAQDFKD DPNVVSLGQN WARQDAVFPV DDGKLTGRVR DLQSCFNLNS       120
     LSVPLKDGIS GDDLEKQPYP VKVFKALLKQ LEVEDYEAVQ LTDAIRDWTD KDTVLVSSYG       180
     AEDAYYEGLT PPYLTANQWM LGTDELRAVR GVSAKLYARL APYVCALPND KLVVNVNTIR       240
     PEQSALLVAL YLDKVGLDDA KRVLTSRPQK GWKNKKEMTD QMPVQVGNIQ GLDAALDVKS       300
     SYFEARLIAE VGDTRARLES VFVRGKDNKL VMLRRLNGGA E                           341
//

If you have problems or comments...

PBIL Back to PBIL home page