(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPM

CP000462.GSPM        Location/Qualifiers
FT   CDS             613223..613714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="AHA_0578"
FT                   /product="general secretion pathway protein M"
FT                   /note="identified by similarity to SP:P41850; match to
FT                   protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37544"
FT                   /db_xref="GOA:A0KFT5"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT5"
FT                   /protein_id="ABK37544.1"
FT                   /translation="MMDKLQGWWRGISAREQRLVAVGGSVLLIGFCYWVIWQPIGNRID
FT                   ERERQVLSQQQTLAWLKEKGEEVLALQGGQGHQLDTSGTLEGVVNRTAFNQKIKIARLQ
FT                   PQGQELQVWIDTVAFDDLLIWLATLADRHGVQVQVIEVARENLAPGLVKVRRLQLSRPQ
FT                   "
     MMDKLQGWWR GISAREQRLV AVGGSVLLIG FCYWVIWQPI GNRIDERERQ VLSQQQTLAW        60
     LKEKGEEVLA LQGGQGHQLD TSGTLEGVVN RTAFNQKIKI ARLQPQGQEL QVWIDTVAFD       120
     DLLIWLATLA DRHGVQVQVI EVARENLAPG LVKVRRLQLS RPQ                         163
//

If you have problems or comments...

PBIL Back to PBIL home page