(data stored in ACNUC7421 zone)

EMBL: CP000462.HEMB

CP000462.HEMB        Location/Qualifiers
FT   CDS             98154..99173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="AHA_0091"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by match to protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39315"
FT                   /db_xref="GOA:A0KEG3"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG3"
FT                   /protein_id="ABK39315.1"
FT                   /translation="MATTLPGAFPGRRLRRVRKHDFSRRLVRENVLTANDLIYPVFVLE
FT                   GENRREAVTSMPGVDRLSIDLLLKEAAELVALGVPAIALFPVTPLEQKSLLAEEAYNPD
FT                   GLAQRATRALKVSFPELGVITDVALDPFTTHGQDGIIDDEGYVLNDITTEILVKQALSH
FT                   AAAGVDIVAPSDMMDGRIGAIRAALEENGFINTQIMAYSAKYASCYYGPFRDAVGSAGN
FT                   LGKSNKATYQMDPANSNEALHEVALDIKEGADSVMVKPGMPYLDVIRQVKDQFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLKEKESIMESLLCFKRAGADGILTYFAKRAAQWLQEDARR"
     MATTLPGAFP GRRLRRVRKH DFSRRLVREN VLTANDLIYP VFVLEGENRR EAVTSMPGVD        60
     RLSIDLLLKE AAELVALGVP AIALFPVTPL EQKSLLAEEA YNPDGLAQRA TRALKVSFPE       120
     LGVITDVALD PFTTHGQDGI IDDEGYVLND ITTEILVKQA LSHAAAGVDI VAPSDMMDGR       180
     IGAIRAALEE NGFINTQIMA YSAKYASCYY GPFRDAVGSA GNLGKSNKAT YQMDPANSNE       240
     ALHEVALDIK EGADSVMVKP GMPYLDVIRQ VKDQFGVPTF AYQVSGEYAM HMAAIQNGWL       300
     KEKESIMESL LCFKRAGADG ILTYFAKRAA QWLQEDARR                              339
//

If you have problems or comments...

PBIL Back to PBIL home page