(data stored in ACNUC7421 zone)

EMBL: CP000462.HEMF

CP000462.HEMF        Location/Qualifiers
FT   CDS             288492..289400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="AHA_0265"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by match to protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36850"
FT                   /db_xref="GOA:A0KEX7"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX7"
FT                   /protein_id="ABK36850.1"
FT                   /translation="MSKPDVAQVKAFLLQLQDEICRGLELADGAGHFVEDAWRREGGGG
FT                   GRTRVLRHGAVIEQGGVNFSHVHGDAMPASATAHRPELAGRRFEAMGVSLVIHPHNPYV
FT                   PTSHANVRFFIAEKEGEEPIWWFGGGFDLTPFYPFEEDVRHWHQLSRDLCQPFGTDIYP
FT                   EFKSWCDRYFFLKHRDETRGVGGLFFDDLNRWPFADCFAFMQAVGKGYLDAYLPIVERR
FT                   KALAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLARWEYDWQ
FT                   PSAGSPEALLYSDYLKPREWL"
     MSKPDVAQVK AFLLQLQDEI CRGLELADGA GHFVEDAWRR EGGGGGRTRV LRHGAVIEQG        60
     GVNFSHVHGD AMPASATAHR PELAGRRFEA MGVSLVIHPH NPYVPTSHAN VRFFIAEKEG       120
     EEPIWWFGGG FDLTPFYPFE EDVRHWHQLS RDLCQPFGTD IYPEFKSWCD RYFFLKHRDE       180
     TRGVGGLFFD DLNRWPFADC FAFMQAVGKG YLDAYLPIVE RRKALAYGER EREFQLYRRG       240
     RYVEFNLVYD RGTLFGLQTG GRTESILMSM PPLARWEYDW QPSAGSPEAL LYSDYLKPRE       300
     WL                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page