(data stored in ACNUC7421 zone)

EMBL: CP000462.HEMN

CP000462.HEMN        Location/Qualifiers
FT   CDS             294669..296042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="AHA_0272"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00538"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38410"
FT                   /db_xref="GOA:A0KEY4"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY4"
FT                   /protein_id="ABK38410.1"
FT                   /translation="MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNEGFGYPDFVQAA
FT                   SQYPARNLSLYVHIPFCHKLCYYCGCNKVITRHRHKADQYLDFLEQEIKAQAPLFKQRL
FT                   VTQLHWGGGTPTYLDEPQTRRLMAMLREHFHFAEEGEISIEVDPREIELSMLDVLREIG
FT                   FNRISLGVQDFNKEVQVAVNREQDNDFIRAMLERARELGFRSTNLDLIYGLPHQNRESF
FT                   HHTLEEVLKTDPARLSIFNYAHLPSRFAAQHKLKEADMPAPQEKLAMLQDTIAFLTGRG
FT                   YQFIGMDHFAKPDDELAVAQREGKLHRNFQGYTTQGDCDLLGLGVSSISMIGDAYSQNQ
FT                   KELKAYYGQVETLGHAQWKGCSLNQDDLIRREVIKRLICDFRLNFAAVEQAHGLVFREY
FT                   FAEDLKLLQTFIDDGLVRMTEEGLEVISTGQLLIRNICMCFDVYLRNKARQQQFSRVI"
     MQAEQIVWDQ ALIEKYNYSG PRYTSYPTAL EFNEGFGYPD FVQAASQYPA RNLSLYVHIP        60
     FCHKLCYYCG CNKVITRHRH KADQYLDFLE QEIKAQAPLF KQRLVTQLHW GGGTPTYLDE       120
     PQTRRLMAML REHFHFAEEG EISIEVDPRE IELSMLDVLR EIGFNRISLG VQDFNKEVQV       180
     AVNREQDNDF IRAMLERARE LGFRSTNLDL IYGLPHQNRE SFHHTLEEVL KTDPARLSIF       240
     NYAHLPSRFA AQHKLKEADM PAPQEKLAML QDTIAFLTGR GYQFIGMDHF AKPDDELAVA       300
     QREGKLHRNF QGYTTQGDCD LLGLGVSSIS MIGDAYSQNQ KELKAYYGQV ETLGHAQWKG       360
     CSLNQDDLIR REVIKRLICD FRLNFAAVEQ AHGLVFREYF AEDLKLLQTF IDDGLVRMTE       420
     EGLEVISTGQ LLIRNICMCF DVYLRNKARQ QQFSRVI                                457
//

If you have problems or comments...

PBIL Back to PBIL home page