(data stored in ACNUC7421 zone)

EMBL: CP000462.HUTU

CP000462.HUTU        Location/Qualifiers
FT   CDS             395229..396938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="AHA_0379"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="identified by match to protein family HMM PF01175;
FT                   match to protein family HMM TIGR01228"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37402"
FT                   /db_xref="GOA:A0KF86"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF86"
FT                   /protein_id="ABK37402.1"
FT                   /translation="MSQQHQDPRHDPNRVIRAPRGTTLTAKSWLTEAPLRMLMNNLDPE
FT                   VAEHPQSLVVYGGIGRAARNWACFDKIVEVLTRLEEDQTLLVQSGKPVGVFQTHKDAPR
FT                   VLIANSNLVPHWANWEHFNELDKKGLMMYGQMTAGSWIYIGTQGIVQGTYETFFAVANQ
FT                   HFNGEPKGRWILTGGLGGMGGAQPLAATMAGFSMIAVECDETRIDFRLRTRYVDKKAHS
FT                   LDEALAMIEEAKQSGSAVSVGLLGNAADVFAELVARGITPDVVTDQTSAHDPVHGYLPQ
FT                   GWSVAQWRALQKSAPQEVNVAARHSMARQVEAMLTLQSRGAATLDYGNNIRQMALEEGV
FT                   KNAFDFPGFVPAYIRPLFCEGIGPFRWVALSGDPEDIYKTDQKVKELIPDDPHLHNWLD
FT                   MARDRIAFQGLPARICWVGVKDRVRLGLAFNEMVKNGELKAPIVIGRDHLDSGSVASPN
FT                   RETESMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGFSQHSGVVIVCDGSDD
FT                   AAKRVGRVLRNDPATGVMRHADAGYEIAINCAHEAKLDLPMIDGANGVKGKV"
     MSQQHQDPRH DPNRVIRAPR GTTLTAKSWL TEAPLRMLMN NLDPEVAEHP QSLVVYGGIG        60
     RAARNWACFD KIVEVLTRLE EDQTLLVQSG KPVGVFQTHK DAPRVLIANS NLVPHWANWE       120
     HFNELDKKGL MMYGQMTAGS WIYIGTQGIV QGTYETFFAV ANQHFNGEPK GRWILTGGLG       180
     GMGGAQPLAA TMAGFSMIAV ECDETRIDFR LRTRYVDKKA HSLDEALAMI EEAKQSGSAV       240
     SVGLLGNAAD VFAELVARGI TPDVVTDQTS AHDPVHGYLP QGWSVAQWRA LQKSAPQEVN       300
     VAARHSMARQ VEAMLTLQSR GAATLDYGNN IRQMALEEGV KNAFDFPGFV PAYIRPLFCE       360
     GIGPFRWVAL SGDPEDIYKT DQKVKELIPD DPHLHNWLDM ARDRIAFQGL PARICWVGVK       420
     DRVRLGLAFN EMVKNGELKA PIVIGRDHLD SGSVASPNRE TESMMDGSDA VSDWPLLNAL       480
     LNTAGGATWV SLHHGGGVGM GFSQHSGVVI VCDGSDDAAK RVGRVLRNDP ATGVMRHADA       540
     GYEIAINCAH EAKLDLPMID GANGVKGKV                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page