(data stored in ACNUC7421 zone)

EMBL: CP000462.ILVC

CP000462.ILVC        Location/Qualifiers
FT   CDS             173624..175105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="AHA_0153"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38758"
FT                   /db_xref="GOA:A0KEM1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM1"
FT                   /protein_id="ABK38758.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMQREEFADGCNVLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDISYALRKAAITEKRASWQKATDNGFAVGTYEELIPTADLVLN
FT                   LTPDKQHSDVVKTVMPLMKQGAALGYSHGFNVVEEGQQIRADITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCYDKLVAEGTDPAYAGKLIQFGWETITEALKQGGISLMMDRLSNPA
FT                   KLRAFELSEQLKTLMRPLFEKHMDDIIAGEFSRGMMADWAEDDAKLFGWREETGKSAFE
FT                   NAPAFAGKIAEQEYFDNGVVMVAMVKAGVELAFETMVASGIYEESAYYESLHELPLIAN
FT                   TVARKRLYEMNVVISDTAEYGNYLFANAAVPLLREHFMPTLKAGDLGASKAEGQSVDNL
FT                   ALLAANEATRNHPIEKIGQVLRGYMKDMKRIAVGG"
     MANYFNTLNL RQQLAQLGKC RFMQREEFAD GCNVLKGKKV VIVGCGAQGL NQGLNMRDSG        60
     LDISYALRKA AITEKRASWQ KATDNGFAVG TYEELIPTAD LVLNLTPDKQ HSDVVKTVMP       120
     LMKQGAALGY SHGFNVVEEG QQIRADITVV MVAPKCPGTE VREEYKRGFG VPTLIAVHPE       180
     NDPKGEGMAI AKAWASATGG DRAGVLESSF VAEVKSDLMG EQTILCGMLQ AGSLLCYDKL       240
     VAEGTDPAYA GKLIQFGWET ITEALKQGGI SLMMDRLSNP AKLRAFELSE QLKTLMRPLF       300
     EKHMDDIIAG EFSRGMMADW AEDDAKLFGW REETGKSAFE NAPAFAGKIA EQEYFDNGVV       360
     MVAMVKAGVE LAFETMVASG IYEESAYYES LHELPLIANT VARKRLYEMN VVISDTAEYG       420
     NYLFANAAVP LLREHFMPTL KAGDLGASKA EGQSVDNLAL LAANEATRNH PIEKIGQVLR       480
     GYMKDMKRIA VGG                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page