(data stored in ACNUC7421 zone)

EMBL: CP000462.KDPA

CP000462.KDPA        Location/Qualifiers
FT   CDS             complement(18662..20344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="AHA_0017"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF03814;
FT                   match to protein family HMM TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38073"
FT                   /db_xref="GOA:A0KED5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED5"
FT                   /protein_id="ABK38073.1"
FT                   /translation="MWQEIIYPVAFVLLVLLPAPLLGNYLYRVFEGKSRWLAPLERATL
FT                   ACCGTDGREQDWKSYALSLLAFNGAGFGLLFLILLAQGLLPLNPQQLPGLNWQLAFNTA
FT                   VSFMTNTNWQAYSGEASLSYFSQMVGLTTQNFVSAATGAAVAIALFRGIARQQTTHLGN
FT                   FWQDLVRFCLYVLLPMALILALLLVWQGVPQSLSAYLPFHALEGQEQLLPLGPAASQIA
FT                   IKQLGSNGGGFFGINSAHPFENPTALSNWLEMVALLTLAAAMVCTLGRYVKDLAHSRAI
FT                   LIAMTIMLVLGLCLAIGQELQPDPALAHLTSEAGNWEGKESRFGPVLSSIWEVATTAAS
FT                   NGSVNAMHDSFAPLAGMVAMINMLLGEVVFGGVGAGIYGMMLFVLLTVFLCGLMVGRTP
FT                   TYLGKRLGITEMKWVVASMLVMPVGVLVIGGITLLMPDSATVIGHDGPHGLSRLIYAYA
FT                   SAAGNNGSAFAGFAAADSWQCIAIGLAMLLGRFGYIIPVLAIAGQLARAPRQERSEGDF
FT                   PVSGPLFITLLIVTVLLMGGLSFLPVLALGPVAEHLSLLGGAF"
     MWQEIIYPVA FVLLVLLPAP LLGNYLYRVF EGKSRWLAPL ERATLACCGT DGREQDWKSY        60
     ALSLLAFNGA GFGLLFLILL AQGLLPLNPQ QLPGLNWQLA FNTAVSFMTN TNWQAYSGEA       120
     SLSYFSQMVG LTTQNFVSAA TGAAVAIALF RGIARQQTTH LGNFWQDLVR FCLYVLLPMA       180
     LILALLLVWQ GVPQSLSAYL PFHALEGQEQ LLPLGPAASQ IAIKQLGSNG GGFFGINSAH       240
     PFENPTALSN WLEMVALLTL AAAMVCTLGR YVKDLAHSRA ILIAMTIMLV LGLCLAIGQE       300
     LQPDPALAHL TSEAGNWEGK ESRFGPVLSS IWEVATTAAS NGSVNAMHDS FAPLAGMVAM       360
     INMLLGEVVF GGVGAGIYGM MLFVLLTVFL CGLMVGRTPT YLGKRLGITE MKWVVASMLV       420
     MPVGVLVIGG ITLLMPDSAT VIGHDGPHGL SRLIYAYASA AGNNGSAFAG FAAADSWQCI       480
     AIGLAMLLGR FGYIIPVLAI AGQLARAPRQ ERSEGDFPVS GPLFITLLIV TVLLMGGLSF       540
     LPVLALGPVA EHLSLLGGAF                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page