(data stored in ACNUC7421 zone)

EMBL: CP000462.KDPC

CP000462.KDPC        Location/Qualifiers
FT   CDS             complement(15961..16488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="AHA_0015"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37221"
FT                   /db_xref="GOA:A0KED3"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED3"
FT                   /protein_id="ABK37221.1"
FT                   /translation="MIAIRTLLTLTLLLGVAYPLAVTGLAQLLFPWQANGSLLTNAKQQ
FT                   VVGSALLAQKFERADYFHSRPSASDFATIGGGASNLGMSSPLRAEFAAAAARAQPEARV
FT                   PALLTRSASGLDPHLPLAAALAQVERVAGQRGLDPVQLTEQVKSAAQAGILGPQVVNIL
FT                   QLNLQLDHQKGA"
     MIAIRTLLTL TLLLGVAYPL AVTGLAQLLF PWQANGSLLT NAKQQVVGSA LLAQKFERAD        60
     YFHSRPSASD FATIGGGASN LGMSSPLRAE FAAAAARAQP EARVPALLTR SASGLDPHLP       120
     LAAALAQVER VAGQRGLDPV QLTEQVKSAA QAGILGPQVV NILQLNLQLD HQKGA            175
//

If you have problems or comments...

PBIL Back to PBIL home page