(data stored in ACNUC7421 zone)

EMBL: CP000462.LEXA

CP000462.LEXA        Location/Qualifiers
FT   CDS             200198..200821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="AHA_0183"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="identified by similarity to SP:P0A7C2; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   PF01726; match to protein family HMM TIGR00498"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36241"
FT                   /db_xref="GOA:Q44069"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44069"
FT                   /protein_id="ABK36241.1"
FT                   /translation="MKPLTPRQAEVLELIKANMNETGMPPTRAEIAQKLGFKSANAAEE
FT                   HLKALAKKGVIEIMPGTSRGIRLLLEEEEPLEESGLPLIGKVAAGEPILAQEHIESHYQ
FT                   VDPALFHPRADFLLRVQGMSMKNIGILDGDLLAVHKTQEVRNGQVVVARLDEDVTVKRF
FT                   QRKGSQVWLLPENEELSPIEVDLSCQQLTIEGLAVGVIRNADWM"
     MKPLTPRQAE VLELIKANMN ETGMPPTRAE IAQKLGFKSA NAAEEHLKAL AKKGVIEIMP        60
     GTSRGIRLLL EEEEPLEESG LPLIGKVAAG EPILAQEHIE SHYQVDPALF HPRADFLLRV       120
     QGMSMKNIGI LDGDLLAVHK TQEVRNGQVV VARLDEDVTV KRFQRKGSQV WLLPENEELS       180
     PIEVDLSCQQ LTIEGLAVGV IRNADWM                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page