(data stored in ACNUC7421 zone)

EMBL: CP000462.MENC

CP000462.MENC        Location/Qualifiers
FT   CDS             complement(561728..562657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="AHA_0528"
FT                   /product="o-succinylbenzoic acid (OSB) synthetase"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM TIGR01927"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37251"
FT                   /db_xref="GOA:A0KFN5"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN5"
FT                   /protein_id="ABK37251.1"
FT                   /translation="MTLALYRYQLPFTQPLTFHGKVEVAREGLLVRVDDGWGEIAPLPG
FT                   FSRESLAEAQAEAIASLEQLAAGQEIAPQLPSVQFGLDCARRCWPAQTTPLPEPYPLIQ
FT                   GSPQELLKHWKNWLHTTPSKAKLKVARYPMRDELALIRLLCDRIPTLKLVLDANQGWTR
FT                   EEAWAFCGHLDPNRIEYLEDPCANFADIAFVANRTGMPVAIDELLAQGKPWEPIPQLRA
FT                   LVLKPTLLGSLAHCEALVARARELRLKVIVSSCFESGLGLNQLFHLAGEWAPDQAPGLD
FT                   TRRWLAADLLDATGKPDLSLLEPLFHRD"
     MTLALYRYQL PFTQPLTFHG KVEVAREGLL VRVDDGWGEI APLPGFSRES LAEAQAEAIA        60
     SLEQLAAGQE IAPQLPSVQF GLDCARRCWP AQTTPLPEPY PLIQGSPQEL LKHWKNWLHT       120
     TPSKAKLKVA RYPMRDELAL IRLLCDRIPT LKLVLDANQG WTREEAWAFC GHLDPNRIEY       180
     LEDPCANFAD IAFVANRTGM PVAIDELLAQ GKPWEPIPQL RALVLKPTLL GSLAHCEALV       240
     ARARELRLKV IVSSCFESGL GLNQLFHLAG EWAPDQAPGL DTRRWLAADL LDATGKPDLS       300
     LLEPLFHRD                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page