(data stored in ACNUC7421 zone)

EMBL: CP000462.META

CP000462.META        Location/Qualifiers
FT   CDS             521085..522038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="AHA_0489"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="identified by match to protein family HMM PF04204;
FT                   match to protein family HMM TIGR01001"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39388"
FT                   /db_xref="GOA:A0KFJ6"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFJ6"
FT                   /protein_id="ABK39388.1"
FT                   /translation="MPIKIPDQLPAAEVLGQENIFVMTESRAVTQNIRPLRVLILNLMP
FT                   KKIETEIQLMRMLSNSPLQVDVDLLRIDDRESKNTPQAHLENFYHDFEQVRGNNYDGMI
FT                   ITGAPLGLVEFEEVVYWPRIVEIIEWSHQHVTSTLFLCWAVQAALKALYGMEKQTHGEK
FT                   LSGVYRHHRLDEHEPLLRGFDDEFVAPHSRYAAFDGDLIRAHTDLQIFAESAEAGVYLA
FT                   ATKDCRQVFVTGHPEYDALTLDGEYQRDLAAGLEPVIPVNYYPDNDPTRTPRASWRSHG
FT                   HLLFSNWLNYYVYQLTSYRVEDIGKVFTYQQNSPSR"
     MPIKIPDQLP AAEVLGQENI FVMTESRAVT QNIRPLRVLI LNLMPKKIET EIQLMRMLSN        60
     SPLQVDVDLL RIDDRESKNT PQAHLENFYH DFEQVRGNNY DGMIITGAPL GLVEFEEVVY       120
     WPRIVEIIEW SHQHVTSTLF LCWAVQAALK ALYGMEKQTH GEKLSGVYRH HRLDEHEPLL       180
     RGFDDEFVAP HSRYAAFDGD LIRAHTDLQI FAESAEAGVY LAATKDCRQV FVTGHPEYDA       240
     LTLDGEYQRD LAAGLEPVIP VNYYPDNDPT RTPRASWRSH GHLLFSNWLN YYVYQLTSYR       300
     VEDIGKVFTY QQNSPSR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page