(data stored in ACNUC7421 zone)

EMBL: CP000462.METB

CP000462.METB        Location/Qualifiers
FT   CDS             622690..623853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="AHA_0589"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.48"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR02080"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39105"
FT                   /db_xref="GOA:A0KFU6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU6"
FT                   /protein_id="ABK39105.1"
FT                   /translation="MTHKATQAVRTGIETDQQHGAVVPPIYLSSNYTFADFGEPRQYDY
FT                   ARSGNPTRTNLADALAALEGGAGAVVTGTGMGAVHLVTTALLKAGDLLLAPHDCYGGTW
FT                   RLFEYLAAKGHYRVQFVDQGDAAALAEALAQQPALVWVETPSNPLLRVVDIAAIAEASH
FT                   AAGAKVAVDNTFLSPLLQQPLALGADLVVHSTTKYINGHSDVVGGVAIAKDPELADSLV
FT                   WWANCLGLTSGAFDSYLTLRGLRTLAPRLRAHQENTDRILAFLQQQPLVKRIYHPSLPS
FT                   HPGHDIARRQQSGFGAMLSFELDCSEAGIRAFLAALTLFSVAESLGGVESLVAHPASMT
FT                   HRAMTPAAQQAAGISSQLLRLSVGIEHGEDLVADLAAAFAQAQQVAK"
     MTHKATQAVR TGIETDQQHG AVVPPIYLSS NYTFADFGEP RQYDYARSGN PTRTNLADAL        60
     AALEGGAGAV VTGTGMGAVH LVTTALLKAG DLLLAPHDCY GGTWRLFEYL AAKGHYRVQF       120
     VDQGDAAALA EALAQQPALV WVETPSNPLL RVVDIAAIAE ASHAAGAKVA VDNTFLSPLL       180
     QQPLALGADL VVHSTTKYIN GHSDVVGGVA IAKDPELADS LVWWANCLGL TSGAFDSYLT       240
     LRGLRTLAPR LRAHQENTDR ILAFLQQQPL VKRIYHPSLP SHPGHDIARR QQSGFGAMLS       300
     FELDCSEAGI RAFLAALTLF SVAESLGGVE SLVAHPASMT HRAMTPAAQQ AAGISSQLLR       360
     LSVGIEHGED LVADLAAAFA QAQQVAK                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page