(data stored in ACNUC7421 zone)

EMBL: CP000462.METJ

CP000462.METJ        Location/Qualifiers
FT   CDS             complement(622158..622481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="AHA_0588"
FT                   /product="met repressor"
FT                   /note="identified by similarity to SP:P0A8U6; match to
FT                   protein family HMM PF01340"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38234"
FT                   /db_xref="GOA:A0KFU5"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU5"
FT                   /protein_id="ABK38234.1"
FT                   /translation="MGTEWNGDYVSPYAEHGKKSEQVKKITVSIPLKVLKVLTDERTRR
FT                   QVNNLRHATNSELLCEAFLHAFTGQPLPCDEDLRKDHPDSVPAEARAIMEALGKEIEDF
FT                   DAE"
     MGTEWNGDYV SPYAEHGKKS EQVKKITVSI PLKVLKVLTD ERTRRQVNNL RHATNSELLC        60
     EAFLHAFTGQ PLPCDEDLRK DHPDSVPAEA RAIMEALGKE IEDFDAE                     107
//

If you have problems or comments...

PBIL Back to PBIL home page