(data stored in ACNUC7421 zone)

EMBL: CP000462.MREB

CP000462.MREB        Location/Qualifiers
FT   CDS             422371..423411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="AHA_0400"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39102"
FT                   /db_xref="GOA:A0KFA7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA7"
FT                   /protein_id="ABK39102.1"
FT                   /translation="MFKKLRGVFSNDLSIDLGTANTLIYVKDQGIVLNEPSVVAIRQER
FT                   GNAKSVAAVGHAAKQMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNNYFR
FT                   PSPRVLVCVPCGSTQVERRAIKESALGAGAREVYLIDEPMAAAIGAGLPVSEATGSMVV
FT                   DIGGGTTEVAIISLNGVVYSQSVRIGGDKFDEAIISYVRRNYGSLIGEATAERIKHEIG
FT                   SAYPGEEVREIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPPEL
FT                   ASDISERGMVLTGGGALLKDIDRLLMEETGIPVVVAEDPLTCVARGGGKALELIDMHGG
FT                   DLFHYE"
     MFKKLRGVFS NDLSIDLGTA NTLIYVKDQG IVLNEPSVVA IRQERGNAKS VAAVGHAAKQ        60
     MLGRTPGNIS AIRPMKDGVI ADFYVTEKML QHFIKQVHDN NYFRPSPRVL VCVPCGSTQV       120
     ERRAIKESAL GAGAREVYLI DEPMAAAIGA GLPVSEATGS MVVDIGGGTT EVAIISLNGV       180
     VYSQSVRIGG DKFDEAIISY VRRNYGSLIG EATAERIKHE IGSAYPGEEV REIEVRGRNL       240
     AEGVPRSFTL NSNEILEALQ EPLSGIVSAV MVALEQSPPE LASDISERGM VLTGGGALLK       300
     DIDRLLMEET GIPVVVAEDP LTCVARGGGK ALELIDMHGG DLFHYE                      346
//

If you have problems or comments...

PBIL Back to PBIL home page