(data stored in ACNUC7421 zone)

EMBL: CP000462.MUTM

CP000462.MUTM        Location/Qualifiers
FT   CDS             182978..183790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="AHA_0164"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38933"
FT                   /db_xref="GOA:A0KEN2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEN2"
FT                   /protein_id="ABK38933.1"
FT                   /translation="MPELPEVEVSRQGISPWLTGIKVTRVVVRDGRLRWPVPGEIQELV
FT                   DLTIHRVSRRAKYLLLETDFGTAILHLGMSGSLRVLDIGTPAEKHDHVDIELANGKLLR
FT                   LNDPRRFGALLWTREPAEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLMDNQ
FT                   VVVGVGNIYANEALYAAGIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTLKDFT
FT                   SADGKPGYFVQQLQVYGRGGQPCFHCHTLLSEIRLGQRTTVFCSHCQR"
     MPELPEVEVS RQGISPWLTG IKVTRVVVRD GRLRWPVPGE IQELVDLTIH RVSRRAKYLL        60
     LETDFGTAIL HLGMSGSLRV LDIGTPAEKH DHVDIELANG KLLRLNDPRR FGALLWTREP       120
     AEAHALLAKL GPEPLTDAFN ADYLRERAKG RSTAIKTFLM DNQVVVGVGN IYANEALYAA       180
     GIHPKRAAGN ISAERLGTLV AEIKRVLAEA IRQGGTTLKD FTSADGKPGY FVQQLQVYGR       240
     GGQPCFHCHT LLSEIRLGQR TTVFCSHCQR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page