(data stored in ACNUC7421 zone)

EMBL: CP000462.NORV

CP000462.NORV        Location/Qualifiers
FT   CDS             132796..134283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norV"
FT                   /locus_tag="AHA_0119"
FT                   /product="anaerobic nitric oxide reductase flavorubredoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF00301; match to protein
FT                   family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35983"
FT                   /db_xref="GOA:A0KEJ1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR023957"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEJ1"
FT                   /protein_id="ABK35983.1"
FT                   /translation="MSIHVKNNIHWVGQRDWEVRDFHGTEYKTHKGTSYNSYLIREGKN
FT                   VLIDTVDHKFSREFVQNLAAEIDLATIDYVVINHAEEDHAGALTELMARIPGTPIYCTH
FT                   NAIDSITGHHHHPEWNFHPVKTGDSLDIGNGKQLVFIETPMLHWPDSMMTYMTEDAVLF
FT                   SNDAFGQHYCDEHLFNDEVDQTELMEQCQRYYANILTPFSPLVTAKIKEVLGFNLPVSM
FT                   VATSHGIVWREDPTQIILKYLEWADHYQEDRITLFYDSMSNNTRMMADAIAQGIHEVDP
FT                   GVAVKIYNVARHDKNEILTQVFRSKGILVGSSTMNNVMMPKVAGMLEEITGLRFRNKRA
FT                   SAFGSYGWTGGAVDRIQTRLMDAGFDISISLKAKWRPDGSALAECREHGRQLARQWALH
FT                   PLDAPRPLATTQATPAPEMPAAVTAAPKATAAAAEWDDDQAMLCTVCQWVYDPAQGEPD
FT                   QLVAPGTPWAQVPDSFLCPGCGIGKEVFEPCAVEACV"
     MSIHVKNNIH WVGQRDWEVR DFHGTEYKTH KGTSYNSYLI REGKNVLIDT VDHKFSREFV        60
     QNLAAEIDLA TIDYVVINHA EEDHAGALTE LMARIPGTPI YCTHNAIDSI TGHHHHPEWN       120
     FHPVKTGDSL DIGNGKQLVF IETPMLHWPD SMMTYMTEDA VLFSNDAFGQ HYCDEHLFND       180
     EVDQTELMEQ CQRYYANILT PFSPLVTAKI KEVLGFNLPV SMVATSHGIV WREDPTQIIL       240
     KYLEWADHYQ EDRITLFYDS MSNNTRMMAD AIAQGIHEVD PGVAVKIYNV ARHDKNEILT       300
     QVFRSKGILV GSSTMNNVMM PKVAGMLEEI TGLRFRNKRA SAFGSYGWTG GAVDRIQTRL       360
     MDAGFDISIS LKAKWRPDGS ALAECREHGR QLARQWALHP LDAPRPLATT QATPAPEMPA       420
     AVTAAPKATA AAAEWDDDQA MLCTVCQWVY DPAQGEPDQL VAPGTPWAQV PDSFLCPGCG       480
     IGKEVFEPCA VEACV                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page