(data stored in ACNUC7421 zone)

EMBL: CP000462.PCKA

CP000462.PCKA        Location/Qualifiers
FT   CDS             complement(599480..601105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="AHA_0565"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="identified by match to protein family HMM PF01293;
FT                   match to protein family HMM TIGR00224"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38879"
FT                   /db_xref="GOA:A0KFS2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS2"
FT                   /protein_id="ABK38879.1"
FT                   /translation="MTIVAEPTLAKQLGLDQYGIKNSTEILRNPSYDQLFAEETRADLE
FT                   GFERGVVTELGAVNVNTGIFTGRSPKDKYIVKDATTQNTVWWSDQGKNDNKAISPEVWS
FT                   HLKSLVTKQLSGKRLFVVDGFCGANPDTRLAVRIITEVAWQAHFVKNMFIRPSDEELKT
FT                   FKPDFVVMNGAKCTNPNWKEQGLNSENFVAFNLTEKIQLIGGTWYGGEMKKGMFSMMNY
FT                   FLPLRGIASMHCSANVGQDGDVAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFN
FT                   FEGGCYAKTIKLSKEAEPDIYNAIRRDALLENVTVAADGTIDFDDGSKTENTRVSYPIY
FT                   HIENIVKPVSKAGHANKVIFLTADAFGVLPPVSKLTKEQTKYHFLSGFTAKLAGTERGI
FT                   TEPTPTFSSCFGAAFLSLHPTKYGQELVKRMEAAGAEAYLVNTGWNGTGKRISIKDTRA
FT                   IIDAILDGSIEKAETKVLPIFNLEVPTALHDVNPAILDPRDTYANKAEWDAKAVDLAGR
FT                   FIKNFERFTDNEEGKRLVAAGPQL"
     MTIVAEPTLA KQLGLDQYGI KNSTEILRNP SYDQLFAEET RADLEGFERG VVTELGAVNV        60
     NTGIFTGRSP KDKYIVKDAT TQNTVWWSDQ GKNDNKAISP EVWSHLKSLV TKQLSGKRLF       120
     VVDGFCGANP DTRLAVRIIT EVAWQAHFVK NMFIRPSDEE LKTFKPDFVV MNGAKCTNPN       180
     WKEQGLNSEN FVAFNLTEKI QLIGGTWYGG EMKKGMFSMM NYFLPLRGIA SMHCSANVGQ       240
     DGDVAIFFGL SGTGKTTLST DPKRQLIGDD EHGWDDDGVF NFEGGCYAKT IKLSKEAEPD       300
     IYNAIRRDAL LENVTVAADG TIDFDDGSKT ENTRVSYPIY HIENIVKPVS KAGHANKVIF       360
     LTADAFGVLP PVSKLTKEQT KYHFLSGFTA KLAGTERGIT EPTPTFSSCF GAAFLSLHPT       420
     KYGQELVKRM EAAGAEAYLV NTGWNGTGKR ISIKDTRAII DAILDGSIEK AETKVLPIFN       480
     LEVPTALHDV NPAILDPRDT YANKAEWDAK AVDLAGRFIK NFERFTDNEE GKRLVAAGPQ       540
     L                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page