(data stored in ACNUC7421 zone)

EMBL: CP000462.PE100

CP000462.PE100       Location/Qualifiers
FT   CDS             complement(120746..121447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0109"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, ATP-binding protein LivF"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38514"
FT                   /db_xref="GOA:A0KEI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI1"
FT                   /protein_id="ABK38514.1"
FT                   /translation="MLELRNVSTHYGKIQALHDVSVQVKEGEIVTLIGANGAGKTTLLM
FT                   TLCGEPKPSSGSIWFEGEQIDSLSTARIMRKDIAVVPEGRRIFARLTVEENLLMGAFFV
FT                   DKAEQRGLLDQIFTLFPRLHERLEQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEPSLG
FT                   LAPIVIQQIFDTIEQLRRDGMTIFLVEQNANQALKLADRGYVLENGHVVLQDTGAALLA
FT                   NPAVRQAYLGG"
     MLELRNVSTH YGKIQALHDV SVQVKEGEIV TLIGANGAGK TTLLMTLCGE PKPSSGSIWF        60
     EGEQIDSLST ARIMRKDIAV VPEGRRIFAR LTVEENLLMG AFFVDKAEQR GLLDQIFTLF       120
     PRLHERLEQR AGTMSGGEQQ MLAIGRALMS KPRLLLLDEP SLGLAPIVIQ QIFDTIEQLR       180
     RDGMTIFLVE QNANQALKLA DRGYVLENGH VVLQDTGAAL LANPAVRQAY LGG              233
//

If you have problems or comments...

PBIL Back to PBIL home page