(data stored in ACNUC7421 zone)

EMBL: CP000462.PE102

CP000462.PE102       Location/Qualifiers
FT   CDS             complement(122228..123499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0111"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, permease protein LivM"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39456"
FT                   /db_xref="GOA:A0KEI3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI3"
FT                   /protein_id="ABK39456.1"
FT                   /translation="MMKRQLVHACIASLVLLVLSFWLLGFKLETDGTRLLVTSRLDVSL
FT                   AWLLGGATLVFWFQLLRGQISRLFQASISGFSVGFTKLVLPSQEEAPRLYNITAVLVLL
FT                   FAVSWPFMASRGAIDLATLALIYIMLGLGLNVVVGLAGLLDLGYVGFYAVGAYSYALLN
FT                   TYFGLSFWECLPIAGLTAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLNNMTSLT
FT                   GGPNGISGIPKPTLGGLEFNRTVKDGGFETFHEFFGIAYNANHKVIFLYLMALVLVIAT
FT                   LFVINRLLRMPLGRAWEALREDEIACKSLGLNPTIIKLTAFTIGACFAGFAGSFFASRQ
FT                   GFISPESFVFIESAIVLAIVVLGGMGSQIGVVLAAIVMTVLPELAREFNEYRMLMFGLL
FT                   MVFMMIWRPQGLLPMTRPHLELKK"
     MMKRQLVHAC IASLVLLVLS FWLLGFKLET DGTRLLVTSR LDVSLAWLLG GATLVFWFQL        60
     LRGQISRLFQ ASISGFSVGF TKLVLPSQEE APRLYNITAV LVLLFAVSWP FMASRGAIDL       120
     ATLALIYIML GLGLNVVVGL AGLLDLGYVG FYAVGAYSYA LLNTYFGLSF WECLPIAGLT       180
     AATFGFLLGF PVLRLRGDYL AIVTLGFGEI IRILLNNMTS LTGGPNGISG IPKPTLGGLE       240
     FNRTVKDGGF ETFHEFFGIA YNANHKVIFL YLMALVLVIA TLFVINRLLR MPLGRAWEAL       300
     REDEIACKSL GLNPTIIKLT AFTIGACFAG FAGSFFASRQ GFISPESFVF IESAIVLAIV       360
     VLGGMGSQIG VVLAAIVMTV LPELAREFNE YRMLMFGLLM VFMMIWRPQG LLPMTRPHLE       420
     LKK                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page