(data stored in ACNUC7421 zone)

EMBL: CP000462.PE103

CP000462.PE103       Location/Qualifiers
FT   CDS             complement(123496..124422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0112"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system permeaseprotein LivH"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36338"
FT                   /db_xref="GOA:A0KEI4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI4"
FT                   /protein_id="ABK36338.1"
FT                   /translation="MSEHFLYLVQQLLNGLTIGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMIGSYVAFMVMAGLMMMGIDSTFLLLGGAFLVSIVITGTYGWTIERVAYRPLRGGNR
FT                   LIPLISAIGMSIFLQNMMRMAQGSRDIAMPTLISGGWTLGEADGFQASLSWMQLIIFVV
FT                   TFITMLALTQFIGRSRMGRACRACSEDIKMANLLGIDTHVVISITFVLGATLAAVAGVL
FT                   LGMYYGVINPYLGFMAGLKAFTAAVLGGIGSIPGAVLGGLLLGVVEALTAGYLSTEYKD
FT                   VMAFALLIGVLLFMPTGILGRPEVEKV"
     MSEHFLYLVQ QLLNGLTIGS TYALIAIGYT MVYGIIGMIN FAHGEVYMIG SYVAFMVMAG        60
     LMMMGIDSTF LLLGGAFLVS IVITGTYGWT IERVAYRPLR GGNRLIPLIS AIGMSIFLQN       120
     MMRMAQGSRD IAMPTLISGG WTLGEADGFQ ASLSWMQLII FVVTFITMLA LTQFIGRSRM       180
     GRACRACSED IKMANLLGID THVVISITFV LGATLAAVAG VLLGMYYGVI NPYLGFMAGL       240
     KAFTAAVLGG IGSIPGAVLG GLLLGVVEAL TAGYLSTEYK DVMAFALLIG VLLFMPTGIL       300
     GRPEVEKV                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page