(data stored in ACNUC7421 zone)

EMBL: CP000462.PE104

CP000462.PE104       Location/Qualifiers
FT   CDS             complement(124487..125590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0113"
FT                   /product="Leu/Ile/Val-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38195"
FT                   /db_xref="GOA:A0KEI5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI5"
FT                   /protein_id="ABK38195.1"
FT                   /translation="MAVRTAVSMALFGSVSLVHAADTIKIGIAGPVTGPVAQYGDMQFT
FT                   GGKMAVEQINKAGGIKGKQIEAVIYDDACDPKQAVAVANKVINDGVKFVVGHLCSDNTL
FT                   PASDIYEDEGVLMVTPASTNPKITERGYQLVLRTIGLDSDQGPTAAKYIIEQVKPKRVA
FT                   VIHDKKQYGEGIASSVKAALDKAGVKVVAFEGITAGDKDFSALIAKLQKENVDFVYYGG
FT                   YHPELGLILRQAGEKGLKAKFMGPEGVGNKDISAIGGPASEGLLVTLPNKYDLVPANAP
FT                   LVAAFKAKGQDSSGPFVWTTYAAVQTLAAGIAKAGEDDPAAVAAAIKAAPIDTVMGTLS
FT                   WAPSGDLKGFEFGVFQWHADGTSTQVK"
     MAVRTAVSMA LFGSVSLVHA ADTIKIGIAG PVTGPVAQYG DMQFTGGKMA VEQINKAGGI        60
     KGKQIEAVIY DDACDPKQAV AVANKVINDG VKFVVGHLCS DNTLPASDIY EDEGVLMVTP       120
     ASTNPKITER GYQLVLRTIG LDSDQGPTAA KYIIEQVKPK RVAVIHDKKQ YGEGIASSVK       180
     AALDKAGVKV VAFEGITAGD KDFSALIAKL QKENVDFVYY GGYHPELGLI LRQAGEKGLK       240
     AKFMGPEGVG NKDISAIGGP ASEGLLVTLP NKYDLVPANA PLVAAFKAKG QDSSGPFVWT       300
     TYAAVQTLAA GIAKAGEDDP AAVAAAIKAA PIDTVMGTLS WAPSGDLKGF EFGVFQWHAD       360
     GTSTQVK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page