(data stored in ACNUC7421 zone)

EMBL: CP000462.PE105

CP000462.PE105       Location/Qualifiers
FT   CDS             126044..127048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0114"
FT                   /product="ribose operon repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37528"
FT                   /db_xref="GOA:A0KEI6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI6"
FT                   /protein_id="ABK37528.1"
FT                   /translation="MATIKDVASRAGVSISTVSHVLNHTRRVSEDATQKVLEAVAELNY
FT                   APNSVARSLKINSTKTIGMLVTTSANPFFAEVVQGVEAYCFEQGYSLILCNTENQPPRQ
FT                   QHYLRMLMEKRVDGLLVLGTDIDTPLRDMLRIHKNVPQVVLDWGTECDFANVINDNARI
FT                   GARLAVRHLLEQGHRDIVCITGQLAKPTTQQRLDGVRDALGEQGLTLKDEQIFEGDYES
FT                   QSGFDAMQRILALKPRPTAVFAFDDPMAIGAICAAWEAGVKVPDDISMIGYDDVEMARF
FT                   SSPPLTTIRHPKAELGLLAVQQLVSRIRNKELEVESMTVQPELIVRRSVKSLR"
     MATIKDVASR AGVSISTVSH VLNHTRRVSE DATQKVLEAV AELNYAPNSV ARSLKINSTK        60
     TIGMLVTTSA NPFFAEVVQG VEAYCFEQGY SLILCNTENQ PPRQQHYLRM LMEKRVDGLL       120
     VLGTDIDTPL RDMLRIHKNV PQVVLDWGTE CDFANVINDN ARIGARLAVR HLLEQGHRDI       180
     VCITGQLAKP TTQQRLDGVR DALGEQGLTL KDEQIFEGDY ESQSGFDAMQ RILALKPRPT       240
     AVFAFDDPMA IGAICAAWEA GVKVPDDISM IGYDDVEMAR FSSPPLTTIR HPKAELGLLA       300
     VQQLVSRIRN KELEVESMTV QPELIVRRSV KSLR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page