(data stored in ACNUC7421 zone)

EMBL: CP000462.PE108

CP000462.PE108       Location/Qualifiers
FT   CDS             130311..131018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0117"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36363"
FT                   /db_xref="GOA:A0KEI9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI9"
FT                   /protein_id="ABK36363.1"
FT                   /translation="MIYKSVADRLRIRVNGADCRVGDVLPSEKTLASQFGVSRMTVRKA
FT                   VDMLIEWGLVERRHGSGTYVTKKDVQHETKGLSGFTELMREQGRSLTSEVLEFRTMPAP
FT                   PAIASQLRIKVNEPVYFSNRVRSVDGRALLVEESYMPVRLFRTLSVAHLEGSKFAYIEN
FT                   ECQLPIAGNYESFSAVLADRRMAELLHIEQGAPILRLTSLSYGENGEFLNYSIMFRNAN
FT                   DYHVDYHLRRARG"
     MIYKSVADRL RIRVNGADCR VGDVLPSEKT LASQFGVSRM TVRKAVDMLI EWGLVERRHG        60
     SGTYVTKKDV QHETKGLSGF TELMREQGRS LTSEVLEFRT MPAPPAIASQ LRIKVNEPVY       120
     FSNRVRSVDG RALLVEESYM PVRLFRTLSV AHLEGSKFAY IENECQLPIA GNYESFSAVL       180
     ADRRMAELLH IEQGAPILRL TSLSYGENGE FLNYSIMFRN ANDYHVDYHL RRARG            235
//

If you have problems or comments...

PBIL Back to PBIL home page