(data stored in ACNUC7421 zone)

EMBL: CP000462.PE115

CP000462.PE115       Location/Qualifiers
FT   CDS             complement(138783..139262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0124"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36568"
FT                   /db_xref="GOA:A0KEJ6"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ6"
FT                   /protein_id="ABK36568.1"
FT                   /translation="MQLKTLALLLASHLLVGAAGFAAGIYTLPILIAPPAPANEQVAAR
FT                   QAQASFHGTFRRDLQDSDRLHWGEGQVSIGPDAISLMGKLAPGPDYQLYLSPVFVETEA
FT                   DFARLKEKMVKIGPVKTFDNFIVPLPADVNPADYDSVIIWCETFGQFITAARYRQ"
     MQLKTLALLL ASHLLVGAAG FAAGIYTLPI LIAPPAPANE QVAARQAQAS FHGTFRRDLQ        60
     DSDRLHWGEG QVSIGPDAIS LMGKLAPGPD YQLYLSPVFV ETEADFARLK EKMVKIGPVK       120
     TFDNFIVPLP ADVNPADYDS VIIWCETFGQ FITAARYRQ                              159
//

If you have problems or comments...

PBIL Back to PBIL home page