(data stored in ACNUC7421 zone)

EMBL: CP000462.PE117

CP000462.PE117       Location/Qualifiers
FT   CDS             140006..140512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0126"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37508"
FT                   /db_xref="GOA:A0KEJ8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ8"
FT                   /protein_id="ABK37508.1"
FT                   /translation="MLIIFSGLPGSGKSTIARALAQRLGAVYLRIDTIEQAIRDAERTA
FT                   EEMGPAGYFVAYGLARENLKLGSTVITDSVNPIQLTRDAYHDIARSVGVPCLDVEVVCS
FT                   NSKLHRERVENRTVDIEGLALPDWQAVIDRDYQPWNSERLVLDSATLSVTQSVEKIVAA
FT                   LGKPL"
     MLIIFSGLPG SGKSTIARAL AQRLGAVYLR IDTIEQAIRD AERTAEEMGP AGYFVAYGLA        60
     RENLKLGSTV ITDSVNPIQL TRDAYHDIAR SVGVPCLDVE VVCSNSKLHR ERVENRTVDI       120
     EGLALPDWQA VIDRDYQPWN SERLVLDSAT LSVTQSVEKI VAALGKPL                    168
//

If you have problems or comments...

PBIL Back to PBIL home page