(data stored in ACNUC7421 zone)

EMBL: CP000462.PE124

CP000462.PE124       Location/Qualifiers
FT   CDS             complement(148830..149078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37411"
FT                   /db_xref="GOA:A0KEK5"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEK5"
FT                   /protein_id="ABK37411.1"
FT                   /translation="MMSALFCDATHELDAIGLRCPEPVMMVRKKVRLMADGETLLVSAD
FT                   DPSTTRDIPSFCRFMDHTLVASETEQAPYRYLIRKGQ"
     MMSALFCDAT HELDAIGLRC PEPVMMVRKK VRLMADGETL LVSADDPSTT RDIPSFCRFM        60
     DHTLVASETE QAPYRYLIRK GQ                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page