(data stored in ACNUC7421 zone)

EMBL: CP000462.PE125

CP000462.PE125       Location/Qualifiers
FT   CDS             149247..149438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37233"
FT                   /db_xref="GOA:A0KEK6"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK6"
FT                   /protein_id="ABK37233.1"
FT                   /translation="MQVSYGRLQAYAGMGFLSFAMIVMGSPIGNTGTWFGSMVMIGLGL
FT                   WIELSDYYDEDEDENDQS"
     MQVSYGRLQA YAGMGFLSFA MIVMGSPIGN TGTWFGSMVM IGLGLWIELS DYYDEDEDEN        60
     DQS                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page