(data stored in ACNUC7421 zone)

EMBL: CP000462.PE127

CP000462.PE127       Location/Qualifiers
FT   CDS             complement(150754..152169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0136"
FT                   /product="signal transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38358"
FT                   /db_xref="GOA:A0KEK8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK8"
FT                   /protein_id="ABK38358.1"
FT                   /translation="MPRSLLSRMLLLLLLAILLSQTILTGIWMQQIQKRELEGMLSTTR
FT                   NLALSAASTVNFFKSLPLQYRHIALDQLRNMGGSRFFVSLNEEEIHISAIPDSERKTLV
FT                   LKEVQGVLTRKLSDAMAIKVDFSRPEELHVFNNDTLLADLPSSWARYTLSLEPINPPVL
FT                   VTQIEIEPGEWLYLAALLPAPYMTLDDTVMPSNQVRFIALMTVFLCFFTFLLVRWQTRP
FT                   LRRLAKAAVNLGKDIDQPSLKEEGASEIVAATRAFNIMQHRIRRYIDDRERLFSSISHD
FT                   LKTPITRLRLRVELLDDEQQIAKFNKDLDELELMVKGALQTVKDTDIHENIEQLDIDAM
FT                   LEQMAEAMNLHDERLTIEGHCKQPYRGKPLALKRCIGNLVDNGIKYGQRVRIIIMDDEE
FT                   MLILFIMDEGPGLPEDQFERIFEPYYRLSTDLAGTGLGLGIARNIAHAHGGDLVLENRP
FT                   QGGLQATLSLPRQ"
     MPRSLLSRML LLLLLAILLS QTILTGIWMQ QIQKRELEGM LSTTRNLALS AASTVNFFKS        60
     LPLQYRHIAL DQLRNMGGSR FFVSLNEEEI HISAIPDSER KTLVLKEVQG VLTRKLSDAM       120
     AIKVDFSRPE ELHVFNNDTL LADLPSSWAR YTLSLEPINP PVLVTQIEIE PGEWLYLAAL       180
     LPAPYMTLDD TVMPSNQVRF IALMTVFLCF FTFLLVRWQT RPLRRLAKAA VNLGKDIDQP       240
     SLKEEGASEI VAATRAFNIM QHRIRRYIDD RERLFSSISH DLKTPITRLR LRVELLDDEQ       300
     QIAKFNKDLD ELELMVKGAL QTVKDTDIHE NIEQLDIDAM LEQMAEAMNL HDERLTIEGH       360
     CKQPYRGKPL ALKRCIGNLV DNGIKYGQRV RIIIMDDEEM LILFIMDEGP GLPEDQFERI       420
     FEPYYRLSTD LAGTGLGLGI ARNIAHAHGG DLVLENRPQG GLQATLSLPR Q                471
//

If you have problems or comments...

PBIL Back to PBIL home page