(data stored in ACNUC7421 zone)

EMBL: CP000462.PE128

CP000462.PE128       Location/Qualifiers
FT   CDS             complement(152251..152985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0137"
FT                   /product="GltR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38417"
FT                   /db_xref="GOA:A0KEK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK9"
FT                   /protein_id="ABK38417.1"
FT                   /translation="MHIHMSTSKQLLIVDDDQEIRELLNEYLTRAGFEVLTAAEGNEMR
FT                   KLLAQHNPDLIILDIMMPGDDGFTLCQQIRRDSQVPIIMLTAASDEADRVIGLELGADD
FT                   YITKPFSPRELQARIKALLRRAEFRQPEKEKEPSRRLRFAEWTLDTLSHQRTHEDGSLL
FT                   DLSGSDALLLGMFLQQPGVVLDRDTISDATRGRESLPMERGIDVQISRLRQKLGDNGKS
FT                   PRIIKTIRGSGYMLIAEVHEIP"
     MHIHMSTSKQ LLIVDDDQEI RELLNEYLTR AGFEVLTAAE GNEMRKLLAQ HNPDLIILDI        60
     MMPGDDGFTL CQQIRRDSQV PIIMLTAASD EADRVIGLEL GADDYITKPF SPRELQARIK       120
     ALLRRAEFRQ PEKEKEPSRR LRFAEWTLDT LSHQRTHEDG SLLDLSGSDA LLLGMFLQQP       180
     GVVLDRDTIS DATRGRESLP MERGIDVQIS RLRQKLGDNG KSPRIIKTIR GSGYMLIAEV       240
     HEIP                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page