(data stored in ACNUC7421 zone)

EMBL: CP000462.PE13

CP000462.PE13        Location/Qualifiers
FT   CDS             complement(12555..13238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0013"
FT                   /product="KDP operon transcriptional regulatory protein
FT                   KdpE"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37687"
FT                   /db_xref="GOA:A0KED1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED1"
FT                   /protein_id="ABK37687.1"
FT                   /translation="MAHILVIDDEAAIRRFLRISLIAEGHQVSEAVGVNEGLAQYRHLN
FT                   PDLVILDLGLPDGDGIQVLQAIREHHQHPVLVLSARDSEQEKVRLLDAGANDYMSKPFG
FT                   IGEMMARIRVLLRQRAGVSSGEQRHFPQCGLTLDSSSHRVTLGEEEVPLSRKEFALLQA
FT                   LVCHPGKLVLQTQLLNDIWGPSHKEDTHYLRIVIASLRKKLGDNPQQPTLIETESGIGY
FT                   RFIGS"
     MAHILVIDDE AAIRRFLRIS LIAEGHQVSE AVGVNEGLAQ YRHLNPDLVI LDLGLPDGDG        60
     IQVLQAIREH HQHPVLVLSA RDSEQEKVRL LDAGANDYMS KPFGIGEMMA RIRVLLRQRA       120
     GVSSGEQRHF PQCGLTLDSS SHRVTLGEEE VPLSRKEFAL LQALVCHPGK LVLQTQLLND       180
     IWGPSHKEDT HYLRIVIASL RKKLGDNPQQ PTLIETESGI GYRFIGS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page