(data stored in ACNUC7421 zone)

EMBL: CP000462.PE131

CP000462.PE131       Location/Qualifiers
FT   CDS             complement(156833..158770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0140"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /EC_number="6.2.1.16"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR01217"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36572"
FT                   /db_xref="GOA:A0KEL2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL2"
FT                   /protein_id="ABK36572.1"
FT                   /translation="MHNLCLWQPDQERIQQSNLQHFMAEVNRFHGLQLHSYAQLYQWSV
FT                   EKTTRFWPLVWQHCGVKGELGNIVAENRQEMQRTRWFPDSRLNFAENLLRRQDDTPAII
FT                   SRIEGSPSQTLSWRELADQVARLAQWLRGQGIGRGDVVAAYLPNIPQTVVAMLATTSLG
FT                   AIWTSTSPDFGEASVVERFGQTRPRVLFAVDGYHYNGKAIDIQDKVAGVVGQIDSIEQT
FT                   VIIPLLGHPLQLGHDWRQILASQPDASLQFEPMAFNDPLYILYSSGTTGKPKCIVHGIG
FT                   GTLLQHLKEHQLHCDIKPGERIFYFTTCGWMMWNWLVSALASGATLVLYDGSPFYPDGN
FT                   VLWDLARDEEVALFGTSAKYLDALHKQGYAPIKTHQLPQLRLICSTGSVLSPEGFDYVY
FT                   QQIKRDVQLSSISGGTDICSCFVIGNPISPVYRGESQGRGLGLAVQVFNEAGQPVQGEK
FT                   GELVCTKPFPAQPIGFWGDASGDKYHAAYFERFDNIWCHGDWIELTPTGGILFYGRSDA
FT                   TLNPGGVRIGTSEIYRYVEQLEEVEESIVIGQQWQQDERVVLFVKLKPGLMLDEALRER
FT                   IRQQVRLHCTARHVPARILQVDAIPRTKSGKIVELAVREVVHNRPVNNTHALADPEVLS
FT                   QYRDRPELAS"
     MHNLCLWQPD QERIQQSNLQ HFMAEVNRFH GLQLHSYAQL YQWSVEKTTR FWPLVWQHCG        60
     VKGELGNIVA ENRQEMQRTR WFPDSRLNFA ENLLRRQDDT PAIISRIEGS PSQTLSWREL       120
     ADQVARLAQW LRGQGIGRGD VVAAYLPNIP QTVVAMLATT SLGAIWTSTS PDFGEASVVE       180
     RFGQTRPRVL FAVDGYHYNG KAIDIQDKVA GVVGQIDSIE QTVIIPLLGH PLQLGHDWRQ       240
     ILASQPDASL QFEPMAFNDP LYILYSSGTT GKPKCIVHGI GGTLLQHLKE HQLHCDIKPG       300
     ERIFYFTTCG WMMWNWLVSA LASGATLVLY DGSPFYPDGN VLWDLARDEE VALFGTSAKY       360
     LDALHKQGYA PIKTHQLPQL RLICSTGSVL SPEGFDYVYQ QIKRDVQLSS ISGGTDICSC       420
     FVIGNPISPV YRGESQGRGL GLAVQVFNEA GQPVQGEKGE LVCTKPFPAQ PIGFWGDASG       480
     DKYHAAYFER FDNIWCHGDW IELTPTGGIL FYGRSDATLN PGGVRIGTSE IYRYVEQLEE       540
     VEESIVIGQQ WQQDERVVLF VKLKPGLMLD EALRERIRQQ VRLHCTARHV PARILQVDAI       600
     PRTKSGKIVE LAVREVVHNR PVNNTHALAD PEVLSQYRDR PELAS                       645
//

If you have problems or comments...

PBIL Back to PBIL home page