(data stored in ACNUC7421 zone)

EMBL: CP000462.PE136

CP000462.PE136       Location/Qualifiers
FT   CDS             complement(168638..171214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0149"
FT                   /product="acyl-CoA synthetase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36403"
FT                   /db_xref="GOA:A0KEL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL7"
FT                   /protein_id="ABK36403.1"
FT                   /translation="MKPSGLDRLFKPQSIAVIGASTDPQKAGHVVIRHLLAGQFKGPIL
FT                   PVSPHSTAIAGVLAYGDIDSLPLAPDLAIVCTRRERVLTLIEALGKRGAGAAIILAADF
FT                   TAPEREQLQQLSQQYGIRLLGPNSMGMLLPGQGINASFSPIAAKPGQVAFLSQSAAVST
FT                   TILDWAKQHELGFSAFISLGDHCDINFGQLLDQLSRDSVTRAILLYMDKLQDARHFLSA
FT                   ARAASRNKPILVLKSGRHEPDNGLDNVYDAAIRRAGMLRVRDTHELFAAVETLSHSLTL
FT                   KGERLAIISNGRGLANMAIDKLLERGGKLAMPPRDIGSDADINDYQQALDDLLQGDEAD
FT                   AILLIHAPSLTARGAALARSLIDYVKQHPRARRFNILTNWAGEYSAQEGRRLFSEAGFP
FT                   TYRTPESAVAAFMHMVEYRRNQKQLMETPASLQGDRLNLELCQQLIRQALERKQLTLDT
FT                   HLAHPILQAAGLSTLPTWIVSDAIEATLTAEQIGYPVAVKLRSPDILHKSAVHGVMLNL
FT                   RTSAEVAQAADAILDRVRQHDPSARIEGLLVQRMARRSGGLELRIRLQQDPVFGPVILL
FT                   GESGAEPQEMMAALPPLNQALARYQIIGALKSRKIREQASPERLDIDALGQVLCQLSEL
FT                   LLAFPEIQQLDLHPLQACGAEMVVLDASLTLQPAEEGRCRLAIRPYPTELEEGAWLKDQ
FT                   SHVLLRPIRPEDEPAHKQFVLKVSDEDRYKRFFADVGELGHEELARMTQIDYDREMAFV
FT                   AVGQDGPFDQQILGVVRAISNPDLSDAEFAILVRSDLKGLGLGKLMMEKIVRYARERGI
FT                   GQLSGMTMPSNRGMINLAKRLGFKIDIQLEDGVVNMELPCASQGQA"
     MKPSGLDRLF KPQSIAVIGA STDPQKAGHV VIRHLLAGQF KGPILPVSPH STAIAGVLAY        60
     GDIDSLPLAP DLAIVCTRRE RVLTLIEALG KRGAGAAIIL AADFTAPERE QLQQLSQQYG       120
     IRLLGPNSMG MLLPGQGINA SFSPIAAKPG QVAFLSQSAA VSTTILDWAK QHELGFSAFI       180
     SLGDHCDINF GQLLDQLSRD SVTRAILLYM DKLQDARHFL SAARAASRNK PILVLKSGRH       240
     EPDNGLDNVY DAAIRRAGML RVRDTHELFA AVETLSHSLT LKGERLAIIS NGRGLANMAI       300
     DKLLERGGKL AMPPRDIGSD ADINDYQQAL DDLLQGDEAD AILLIHAPSL TARGAALARS       360
     LIDYVKQHPR ARRFNILTNW AGEYSAQEGR RLFSEAGFPT YRTPESAVAA FMHMVEYRRN       420
     QKQLMETPAS LQGDRLNLEL CQQLIRQALE RKQLTLDTHL AHPILQAAGL STLPTWIVSD       480
     AIEATLTAEQ IGYPVAVKLR SPDILHKSAV HGVMLNLRTS AEVAQAADAI LDRVRQHDPS       540
     ARIEGLLVQR MARRSGGLEL RIRLQQDPVF GPVILLGESG AEPQEMMAAL PPLNQALARY       600
     QIIGALKSRK IREQASPERL DIDALGQVLC QLSELLLAFP EIQQLDLHPL QACGAEMVVL       660
     DASLTLQPAE EGRCRLAIRP YPTELEEGAW LKDQSHVLLR PIRPEDEPAH KQFVLKVSDE       720
     DRYKRFFADV GELGHEELAR MTQIDYDREM AFVAVGQDGP FDQQILGVVR AISNPDLSDA       780
     EFAILVRSDL KGLGLGKLMM EKIVRYARER GIGQLSGMTM PSNRGMINLA KRLGFKIDIQ       840
     LEDGVVNMEL PCASQGQA                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page