(data stored in ACNUC7421 zone)

EMBL: CP000462.PE138

CP000462.PE138       Location/Qualifiers
FT   CDS             171648..172520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38330"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL9"
FT                   /protein_id="ABK38330.1"
FT                   /translation="MIRIWLCCVMLLAGSVPAAEVPIRAWNLLLDHPNPAVAALLRLSL
FT                   DLTVPEYGPYRLIASPPMEQGRAVKELQSGELVQIGVFAPDEERERTLLAIHVPLAKGL
FT                   LGWRVCLIRQGDEGRFANIRSLTDWQQAGLRIGQHRSWPDTRLLKENGLNVVVGSLYDA
FT                   LFNMLRKQRFDCFLRSVIEIEEELKQHPELAIEPHLVFRYPLALLFFVSPKYPELAKRI
FT                   ELGLQRARQSGDYERVFEAGFGSTIRRLQLDRRVMLELSNPDLPAGSRAMMQDPSLIYA
FT                   PALSAVSAQ"
     MIRIWLCCVM LLAGSVPAAE VPIRAWNLLL DHPNPAVAAL LRLSLDLTVP EYGPYRLIAS        60
     PPMEQGRAVK ELQSGELVQI GVFAPDEERE RTLLAIHVPL AKGLLGWRVC LIRQGDEGRF       120
     ANIRSLTDWQ QAGLRIGQHR SWPDTRLLKE NGLNVVVGSL YDALFNMLRK QRFDCFLRSV       180
     IEIEEELKQH PELAIEPHLV FRYPLALLFF VSPKYPELAK RIELGLQRAR QSGDYERVFE       240
     AGFGSTIRRL QLDRRVMLEL SNPDLPAGSR AMMQDPSLIY APALSAVSAQ                  290
//

If you have problems or comments...

PBIL Back to PBIL home page